处理AI胡乱生成的乱摊子

This commit is contained in:
2025-09-07 20:31:38 +08:00
parent c377a0784d
commit ba513e0827
202 changed files with 11751 additions and 67183 deletions

22
.gitignore vendored
View File

@@ -1,7 +1,3 @@
# ---> Go
# If you prefer the allow list template instead of the deny list, see community template:
# https://github.com/github/gitignore/blob/main/community/Golang/Go.AllowList.gitignore
#
# Binaries for programs and plugins
*.exe
*.exe~
@@ -9,21 +5,19 @@
*.so
*.dylib
# Test binary, built with `go test -c`
# Test binary, built with go test -c
*.test
# Output of the go coverage tool, specifically when used with LiteIDE
*.out
# Dependency directories (remove the comment below to include it)
# vendor/
# Dependency directories
vendor/
# Go workspace file
go.work
go.work.sum
# IDE-specific files
.idea/
*.swp
*.swo
# env file
# Environment files
.env
.idea
.vscode

27
Makefile Normal file
View File

@@ -0,0 +1,27 @@
# Makefile for pig-farm-controller
# 默认目标
.PHONY: help
help:
@echo "Usage: make [target]"
@echo
@echo "Targets:"
@echo " run Run the application"
@echo " build Build the application"
@echo " clean Clean generated files"
@echo " help Show this help message"
# 运行应用
.PHONY: run
run:
go run main.go
# 构建应用
.PHONY: build
build:
go build -o bin/pig-farm-controller .
# 清理生成文件
.PHONY: clean
clean:
rm -f bin/pig-farm-controller

20
go.mod
View File

@@ -10,35 +10,37 @@ require (
)
require (
github.com/bytedance/sonic v1.9.1 // indirect
github.com/chenzhuoyu/base64x v0.0.0-20221115062448-fe3a3abad311 // indirect
github.com/bytedance/sonic v1.10.0 // indirect
github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d // indirect
github.com/chenzhuoyu/iasm v0.9.0 // indirect
github.com/gabriel-vasile/mimetype v1.4.2 // indirect
github.com/gin-contrib/sse v0.1.0 // indirect
github.com/go-playground/locales v0.14.1 // indirect
github.com/go-playground/universal-translator v0.18.1 // indirect
github.com/go-playground/validator/v10 v10.14.0 // indirect
github.com/goccy/go-json v0.10.2 // indirect
github.com/google/go-cmp v0.6.0 // indirect
github.com/jackc/pgpassfile v1.0.0 // indirect
github.com/jackc/pgservicefile v0.0.0-20221227161230-091c0ba34f0a // indirect
github.com/jackc/pgx/v5 v5.4.3 // indirect
github.com/jinzhu/inflection v1.0.0 // indirect
github.com/jinzhu/now v1.1.5 // indirect
github.com/json-iterator/go v1.1.12 // indirect
github.com/klauspost/cpuid/v2 v2.2.4 // indirect
github.com/klauspost/cpuid/v2 v2.2.5 // indirect
github.com/kr/text v0.2.0 // indirect
github.com/leodido/go-urn v1.2.4 // indirect
github.com/mattn/go-isatty v0.0.19 // indirect
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect
github.com/modern-go/reflect2 v1.0.2 // indirect
github.com/pelletier/go-toml/v2 v2.0.8 // indirect
github.com/pelletier/go-toml/v2 v2.0.9 // indirect
github.com/rogpeppe/go-internal v1.14.1 // indirect
github.com/twitchyliquid64/golang-asm v0.15.1 // indirect
github.com/ugorji/go/codec v1.2.11 // indirect
golang.org/x/arch v0.3.0 // indirect
golang.org/x/crypto v0.14.0 // indirect
golang.org/x/net v0.10.0 // indirect
golang.org/x/arch v0.4.0 // indirect
golang.org/x/crypto v0.28.0 // indirect
golang.org/x/net v0.30.0 // indirect
golang.org/x/sys v0.26.0 // indirect
golang.org/x/text v0.13.0 // indirect
google.golang.org/protobuf v1.30.0 // indirect
golang.org/x/text v0.19.0 // indirect
google.golang.org/protobuf v1.31.0 // indirect
gopkg.in/yaml.v3 v3.0.1 // indirect
)

50
go.sum
View File

@@ -1,9 +1,13 @@
github.com/bytedance/sonic v1.5.0/go.mod h1:ED5hyg4y6t3/9Ku1R6dU/4KyJ48DZ4jPhfY1O2AihPM=
github.com/bytedance/sonic v1.9.1 h1:6iJ6NqdoxCDr6mbY8h18oSO+cShGSMRGCEo7F2h0x8s=
github.com/bytedance/sonic v1.9.1/go.mod h1:i736AoUSYt75HyZLoJW9ERYxcy6eaN6h4BZXU064P/U=
github.com/bytedance/sonic v1.10.0-rc/go.mod h1:ElCzW+ufi8qKqNW0FY314xriJhyJhuoJ3gFZdAHF7NM=
github.com/bytedance/sonic v1.10.0 h1:qtNZduETEIWJVIyDl01BeNxur2rW9OwTQ/yBqFRkKEk=
github.com/bytedance/sonic v1.10.0/go.mod h1:iZcSUejdk5aukTND/Eu/ivjQuEL0Cu9/rf50Hi0u/g4=
github.com/chenzhuoyu/base64x v0.0.0-20211019084208-fb5309c8db06/go.mod h1:DH46F32mSOjUmXrMHnKwZdA8wcEefY7UVqBKYGjpdQY=
github.com/chenzhuoyu/base64x v0.0.0-20221115062448-fe3a3abad311 h1:qSGYFH7+jGhDF8vLC+iwCD4WpbV1EBDSzWkJODFLams=
github.com/chenzhuoyu/base64x v0.0.0-20221115062448-fe3a3abad311/go.mod h1:b583jCggY9gE99b6G5LEC39OIiVsWj+R97kbl5odCEk=
github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d h1:77cEq6EriyTZ0g/qfRdp61a3Uu/AWrgIq2s0ClJV1g0=
github.com/chenzhuoyu/base64x v0.0.0-20230717121745-296ad89f973d/go.mod h1:8EPpVsBuRksnlj1mLy4AWzRNQYxauNi62uWcE3to6eA=
github.com/chenzhuoyu/iasm v0.9.0 h1:9fhXjVzq5hUy2gkhhgHl95zG2cEAhw9OSGs8toWWAwo=
github.com/chenzhuoyu/iasm v0.9.0/go.mod h1:Xjy2NpN3h7aUqeqM+woSuuvxmIe6+DDsiNLIrkAmYog=
github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c=
@@ -25,8 +29,9 @@ github.com/go-playground/validator/v10 v10.14.0/go.mod h1:9iXMNT7sEkjXb0I+enO7QX
github.com/goccy/go-json v0.10.2 h1:CrxCmQqYDkv1z7lO7Wbh2HN93uovUHgrECaO5ZrCXAU=
github.com/goccy/go-json v0.10.2/go.mod h1:6MelG93GURQebXPDq3khkgXZkazVtN9CRI+MGFi0w8I=
github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk=
github.com/google/go-cmp v0.5.5 h1:Khx7svrCpmxxtHBq5j2mp/xVjsi8hQMfNLvJFAlrGgU=
github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI=
github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY=
github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg=
github.com/jackc/pgpassfile v1.0.0 h1:/6Hmqy13Ss2zCq62VdNG8tM1wchn8zjSGOBJ6icpsIM=
github.com/jackc/pgpassfile v1.0.0/go.mod h1:CEx0iS5ambNFdcRtxPj5JhEz+xB6uRky5eyVu/W2HEg=
@@ -41,8 +46,9 @@ github.com/jinzhu/now v1.1.5/go.mod h1:d3SSVoowX0Lcu0IBviAWJpolVfI5UJVZZ7cO71lE/
github.com/json-iterator/go v1.1.12 h1:PV8peI4a0ysnczrg+LtxykD8LfKY9ML6u2jnxaEnrnM=
github.com/json-iterator/go v1.1.12/go.mod h1:e30LSqwooZae/UwlEbR2852Gd8hjQvJoHmT4TnhNGBo=
github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
github.com/klauspost/cpuid/v2 v2.2.4 h1:acbojRNwl3o09bUq+yDCtZFc1aiwaAAxtcn8YkZXnvk=
github.com/klauspost/cpuid/v2 v2.2.4/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg=
github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M=
github.com/kr/pretty v0.3.0 h1:WgNl7dwNpEZ6jJ9k1snq4pZsg7DOEN8hP9Xw0Tsjwk0=
github.com/kr/pretty v0.3.0/go.mod h1:640gp4NfQd8pI5XOwp5fnNeVWj67G7CFk/SaSQn7NBk=
github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY=
@@ -56,8 +62,8 @@ github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd h1:TRLaZ9cD/w
github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q=
github.com/modern-go/reflect2 v1.0.2 h1:xBagoLtFs94CBntxluKeaWgTMpvLxC4ur3nMaC9Gz0M=
github.com/modern-go/reflect2 v1.0.2/go.mod h1:yWuevngMOJpCy52FWWMvUC8ws7m/LJsjYzDa0/r8luk=
github.com/pelletier/go-toml/v2 v2.0.8 h1:0ctb6s9mE31h0/lhu+J6OPmVeDxJn+kYnJc2jZR9tGQ=
github.com/pelletier/go-toml/v2 v2.0.8/go.mod h1:vuYfssBdrU2XDZ9bYydBu6t+6a6PYNcZljzZR9VXg+4=
github.com/pelletier/go-toml/v2 v2.0.9 h1:uH2qQXheeefCCkuBBSLi7jCiSmj3VRh2+Goq2N7Xxu0=
github.com/pelletier/go-toml/v2 v2.0.9/go.mod h1:tJU2Z3ZkXwnxa4DPO899bsyIoywizdUvyaeZurnPPDc=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/rogpeppe/go-internal v1.14.1 h1:UQB4HGPB6osV0SQTLymcB4TgvyWu6ZyliaW0tI/otEQ=
@@ -71,30 +77,29 @@ github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/
github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU=
github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4=
github.com/stretchr/testify v1.8.2/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4=
github.com/stretchr/testify v1.8.3 h1:RP3t2pwF7cMEbC1dqtB6poj3niw/9gnV4Cjg5oW5gtY=
github.com/stretchr/testify v1.8.3/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo=
github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk=
github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo=
github.com/twitchyliquid64/golang-asm v0.15.1 h1:SU5vSMR7hnwNxj24w34ZyCi/FmDZTkS4MhqMhdFk5YI=
github.com/twitchyliquid64/golang-asm v0.15.1/go.mod h1:a1lVb/DtPvCB8fslRZhAngC2+aY1QWCk3Cedj/Gdt08=
github.com/ugorji/go/codec v1.2.11 h1:BMaWp1Bb6fHwEtbplGBGJ498wD+LKlNSl25MjdZY4dU=
github.com/ugorji/go/codec v1.2.11/go.mod h1:UNopzCgEMSXjBc6AOMqYvWC1ktqTAfzJZUZgYf6w6lg=
golang.org/x/arch v0.0.0-20210923205945-b76863e36670/go.mod h1:5om86z9Hs0C8fWVUuoMHwpExlXzs5Tkyp9hOrfG7pp8=
golang.org/x/arch v0.3.0 h1:02VY4/ZcO/gBOH6PUaoiptASxtXU10jazRCP865E97k=
golang.org/x/arch v0.3.0/go.mod h1:5om86z9Hs0C8fWVUuoMHwpExlXzs5Tkyp9hOrfG7pp8=
golang.org/x/crypto v0.14.0 h1:wBqGXzWJW6m1XrIKlAH0Hs1JJ7+9KBwnIO8v66Q9cHc=
golang.org/x/crypto v0.14.0/go.mod h1:MVFd36DqK4CsrnJYDkBA3VC4m2GkXAM0PvzMCn4JQf4=
golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M=
golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/arch v0.4.0 h1:A8WCeEWhLwPBKNbFi5Wv5UTCBx5zzubnXDlMOFAzFMc=
golang.org/x/arch v0.4.0/go.mod h1:5om86z9Hs0C8fWVUuoMHwpExlXzs5Tkyp9hOrfG7pp8=
golang.org/x/crypto v0.28.0 h1:GBDwsMXVQi34v5CCYUm2jkJvu4cbtru2U4TN2PSyQnw=
golang.org/x/crypto v0.28.0/go.mod h1:rmgy+3RHxRZMyY0jjAJShp2zgEdOqj2AO7U0pYmeQ7U=
golang.org/x/net v0.30.0 h1:AcW1SDZMkb8IpzCdQUaIq2sP4sZ4zw+55h6ynffypl4=
golang.org/x/net v0.30.0/go.mod h1:2wGyMJ5iFasEhkwi13ChkO/t1ECNC4X4eBKkVFyYFlU=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.26.0 h1:KHjCJyddX0LoSTb3J+vWpupP9p0oznkqVk/IfjymZbo=
golang.org/x/sys v0.26.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k=
golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543 h1:E7g+9GITq07hpfrRu66IVDexMakfv52eLZ2CXBWiKr4=
golang.org/x/text v0.19.0 h1:kTxAhCbGbxhK0IwgSKiMO5awPoDQ0RpfiVYBfK860YM=
golang.org/x/text v0.19.0/go.mod h1:BuEKDfySbSR4drPmRPG/7iBdf8hvFMuRexcpahXilzY=
golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw=
google.golang.org/protobuf v1.30.0 h1:kPPoIgf3TsEvrm0PFe15JQ+570QVxYzEvvHqChK+cng=
google.golang.org/protobuf v1.30.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
google.golang.org/protobuf v1.31.0 h1:g0LDEJHgrBl9N9r17Ru3sqWhkIx2NB67okBHPwC7hs8=
google.golang.org/protobuf v1.31.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I=
gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk=
gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q=
@@ -107,4 +112,5 @@ gorm.io/driver/postgres v1.5.7 h1:8ptbNJTDbEmhdr62uReG5BGkdQyeasu/FZHxI0IMGnM=
gorm.io/driver/postgres v1.5.7/go.mod h1:3e019WlBaYI5o5LIdNV+LyxCMNtLOQETBXL2h4chKpA=
gorm.io/gorm v1.25.7 h1:VsD6acwRjz2zFxGO50gPO6AkNs7KKnvfzUjHQhZDz/A=
gorm.io/gorm v1.25.7/go.mod h1:hbnx/Oo0ChWMn1BIhpy1oYozzpM15i4YPuHDmfYtwg8=
nullprogram.com/x/optparse v1.0.0/go.mod h1:KdyPE+Igbe0jQUrVfMqDMeJQIJZEuyV7pjYmp6pbG50=
rsc.io/pdf v0.1.1/go.mod h1:n8OzWcQ6Sp37PL01nO98y4iUCRdTGarVfzxY20ICaU4=

View File

@@ -117,6 +117,13 @@ func (a *API) setupRoutes() {
}
// healthHandler 健康检查处理函数
// @Summary 健康检查
// @Description 检查API服务是否正常运行
// @Tags health
// @Accept json
// @Produce json
// @Success 200 {object} map[string]interface{}
// @Router /health [get]
func (a *API) healthHandler(c *gin.Context) {
c.JSON(http.StatusOK, gin.H{
"status": "ok",

View File

@@ -27,6 +27,9 @@ type Application struct {
// Config 应用配置
Config *config.Config
// logger 日志组件实例
logger *logs.Logger
}
// NewApplication 创建并返回一个新的核心应用实例
@@ -50,12 +53,11 @@ func NewApplication(cfg *config.Config) *Application {
taskExecutor := task.NewExecutor(5)
return &Application{
Storage: store,
Storage: store,
API: apiInstance,
TaskExecutor: taskExecutor,
Config: cfg,
logger: logger,
logger: logs.NewLogger(),
}
}

View File

@@ -194,7 +194,7 @@ func (e *Executor) SubmitTask(task Task) {
func (e *Executor) worker(id int) {
defer e.wg.Done()
e.logger.Info(fmt.Sprintf("Worker %d started", id))
e.logger.Info(fmt.Sprintf("Worker (id = %d) started", id))
for {
select {

View File

@@ -1,5 +1,10 @@
// Package main 是猪场控制系统的入口点
// 负责初始化核心应用并管理其生命周期
// @title 猪场管理系统API
// @version 1.0
// @description 猪场管理系统API文档
// @host localhost:8086
// @BasePath /
package main
import (

View File

@@ -23,12 +23,12 @@ CPU_avx := amd64
CPU_avx2 := amd64
CPU_sse := amd64
TMPL_avx := fastint_amd64_test fastfloat_amd64_test native_amd64_test native_export_amd64
TMPL_avx2 := fastint_amd64_test fastfloat_amd64_test native_amd64_test native_export_amd64
TMPL_sse := fastint_amd64_test fastfloat_amd64_test native_amd64_test native_export_amd64
TMPL_avx := fastint_amd64_test fastfloat_amd64_test native_amd64_test recover_amd64_test
TMPL_avx2 := fastint_amd64_test fastfloat_amd64_test native_amd64_test recover_amd64_test
TMPL_sse := fastint_amd64_test fastfloat_amd64_test native_amd64_test recover_amd64_test
CFLAGS_avx := -msse -mno-sse4 -mavx -mpclmul -mno-avx2 -DUSE_AVX=1 -DUSE_AVX2=0
CFLAGS_avx2 := -msse -mno-sse4 -mavx -mpclmul -mavx2 -DUSE_AVX=1 -DUSE_AVX2=1
CFLAGS_avx := -msse -mno-sse4 -mavx -mpclmul -mno-avx2 -mstack-alignment=0 -DUSE_AVX=1 -DUSE_AVX2=0
CFLAGS_avx2 := -msse -mno-sse4 -mavx -mpclmul -mavx2 -mstack-alignment=0 -DUSE_AVX=1 -DUSE_AVX2=1
CFLAGS_sse := -msse -mno-sse4 -mno-avx -mno-avx2 -mpclmul
CC_amd64 := clang
@@ -66,7 +66,7 @@ define build_arch
$(eval @cpu := $(value CPU_$(1)))
$(eval @deps := $(foreach tmpl,$(value TMPL_$(1)),${OUT_DIR}/$(1)/${tmpl}.go))
$(eval @asmin := ${TMP_DIR}/$(1)/native.s)
$(eval @asmout := ${OUT_DIR}/$(1)/native_${@cpu}.s)
$(eval @asmout := ${OUT_DIR}/$(1)/native_text_${@cpu}.go)
$(eval @stubin := ${OUT_DIR}/native_${@cpu}.tmpl)
$(eval @stubout := ${OUT_DIR}/$(1)/native_${@cpu}.go)
@@ -75,8 +75,7 @@ $(1): ${@asmout} ${@deps}
${@asmout}: ${@stubout} ${NATIVE_SRC}
mkdir -p ${TMP_DIR}/$(1)
$${CC_${@cpu}} $${CFLAGS} $${CFLAGS_$(1)} -S -o ${TMP_DIR}/$(1)/native.s ${SRC_FILE}
python3 $${ASM2ASM_${@cpu}} ${@asmout} ${TMP_DIR}/$(1)/native.s
asmfmt -w ${@asmout}
python3 $${ASM2ASM_${@cpu}} -r ${@stubout} ${TMP_DIR}/$(1)/native.s
$(eval $(call \
build_tmpl, \

View File

@@ -5,8 +5,8 @@ English | [中文](README_ZH_CN.md)
A blazingly fast JSON serializing & deserializing library, accelerated by JIT (just-in-time compiling) and SIMD (single-instruction-multiple-data).
## Requirement
- Go 1.15~1.20
- Linux/MacOS/Windows
- Go 1.16~1.21
- Linux / MacOS / Windows(need go1.17 above)
- Amd64 ARCH
## Features
@@ -76,6 +76,10 @@ BenchmarkSetOne_Jsoniter-16 79475 ns/op 163.8
BenchmarkSetOne_Parallel_Sonic-16 850.9 ns/op 15305.31 MB/s 1584 B/op 17 allocs/op
BenchmarkSetOne_Parallel_Sjson-16 18194 ns/op 715.77 MB/s 52247 B/op 9 allocs/op
BenchmarkSetOne_Parallel_Jsoniter-16 33560 ns/op 388.05 MB/s 45892 B/op 964 allocs/op
BenchmarkLoadNode/LoadAll()-16 11384 ns/op 1143.93 MB/s 6307 B/op 25 allocs/op
BenchmarkLoadNode_Parallel/LoadAll()-16 5493 ns/op 2370.68 MB/s 7145 B/op 25 allocs/op
BenchmarkLoadNode/Interface()-16 17722 ns/op 734.85 MB/s 13323 B/op 88 allocs/op
BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.70 MB/s 15178 B/op 88 allocs/op
```
- [Small](https://github.com/bytedance/sonic/blob/main/testdata/small.go) (400B, 11 keys, 3 layers)
![small benchmarks](./docs/imgs/bench-small.png)
@@ -282,6 +286,42 @@ println(string(buf) == string(exp)) // true
- iteration: `Values()`, `Properties()`, `ForEach()`, `SortKeys()`
- modification: `Set()`, `SetByIndex()`, `Add()`
### Ast.Visitor
Sonic provides an advanced API for fully parsing JSON into non-standard types (neither `struct` not `map[string]interface{}`) without using any intermediate representation (`ast.Node` or `interface{}`). For example, you might have the following types which are like `interface{}` but actually not `interface{}`:
```go
type UserNode interface {}
// the following types implement the UserNode interface.
type (
UserNull struct{}
UserBool struct{ Value bool }
UserInt64 struct{ Value int64 }
UserFloat64 struct{ Value float64 }
UserString struct{ Value string }
UserObject struct{ Value map[string]UserNode }
UserArray struct{ Value []UserNode }
)
```
Sonic provides the following API to return **the preorder traversal of a JSON AST**. The `ast.Visitor` is a SAX style interface which is used in some C++ JSON library. You should implement `ast.Visitor` by yourself and pass it to `ast.Preorder()` method. In your visitor you can make your custom types to represent JSON values. There may be an O(n) space container (such as stack) in your visitor to record the object / array hierarchy.
```go
func Preorder(str string, visitor Visitor, opts *VisitorOptions) error
type Visitor interface {
OnNull() error
OnBool(v bool) error
OnString(v string) error
OnInt64(v int64, n json.Number) error
OnFloat64(v float64, n json.Number) error
OnObjectBegin(capacity int) error
OnObjectKey(key string) error
OnObjectEnd() error
OnArrayBegin(capacity int) error
OnArrayEnd() error
}
```
See [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) for detailed usage. We also implement a demo visitor for `UserNode` in [ast/visitor_test.go](https://github.com/bytedance/sonic/blob/main/ast/visitor_test.go).
## Compatibility
Sonic **DOES NOT** ensure to support all environments, due to the difficulty of developing high-performance codes. For developers who use sonic to build their applications in different environments, we have the following suggestions:
@@ -358,5 +398,14 @@ Why? Because `ast.Node` stores its children using `array`:
**CAUTION:** `ast.Node` **DOESN'T** ensure concurrent security directly, due to its **lazy-load** design. However, you can call `Node.Load()`/`Node.LoadAll()` to achieve that, which may bring performance reduction while it still works faster than converting to `map` or `interface{}`
### Ast.Node or Ast.Visitor?
For generic data, `ast.Node` should be enough for your needs in most cases.
However, `ast.Node` is designed for partially processing JSON string. It has some special designs such as lazy-load which might not be suitable for directly parsing the whole JSON string like `Unmarshal()`. Although `ast.Node` is better then `map` or `interface{}`, it's also a kind of intermediate representation after all if your final types are customized and you have to convert the above types to your custom types after parsing.
For better performance, in previous case the `ast.Visitor` will be the better choice. It performs JSON decoding like `Unmarshal()` and you can directly use your final types to represents a JSON AST without any intermediate representations.
But `ast.Visitor` is not a very handy API. You might need to write a lot of code to implement your visitor and carefully maintain the tree hierarchy during decoding. Please read the comments in [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) carefully if you decide to use this API.
## Community
Sonic is a subproject of [CloudWeGo](https://www.cloudwego.io/). We are committed to building a cloud native ecosystem.

View File

@@ -6,8 +6,8 @@
## 依赖
- Go 1.15~1.20
- Linux/MacOS/Windows
- Go 1.16~1.20
- Linux / MacOS / Windows(需要 Go1.17 以上)
- Amd64 架构
## 特色
@@ -79,6 +79,10 @@ BenchmarkSetOne_Jsoniter-16 79475 ns/op 163.8
BenchmarkSetOne_Parallel_Sonic-16 850.9 ns/op 15305.31 MB/s 1584 B/op 17 allocs/op
BenchmarkSetOne_Parallel_Sjson-16 18194 ns/op 715.77 MB/s 52247 B/op 9 allocs/op
BenchmarkSetOne_Parallel_Jsoniter-16 33560 ns/op 388.05 MB/s 45892 B/op 964 allocs/op
BenchmarkLoadNode/LoadAll()-16 11384 ns/op 1143.93 MB/s 6307 B/op 25 allocs/op
BenchmarkLoadNode_Parallel/LoadAll()-16 5493 ns/op 2370.68 MB/s 7145 B/op 25 allocs/op
BenchmarkLoadNode/Interface()-16 17722 ns/op 734.85 MB/s 13323 B/op 88 allocs/op
BenchmarkLoadNode_Parallel/Interface()-16 10330 ns/op 1260.70 MB/s 15178 B/op 88 allocs/op
```
- [小型](https://github.com/bytedance/sonic/blob/main/testdata/small.go) (400B, 11 个键, 3 层)
![small benchmarks](./docs/imgs/bench-small.png)
@@ -298,6 +302,41 @@ println(string(buf) == string(exp)) // true
- 迭代: `Values()`, `Properties()`, `ForEach()`, `SortKeys()`
- 修改: `Set()`, `SetByIndex()`, `Add()`
### `Ast.Visitor`
Sonic 提供了一个高级的 API 用于直接全量解析 JSON 到非标准容器里 (既不是 `struct` 也不是 `map[string]interface{}`) 且不需要借助任何中间表示 (`ast.Node` 或 `interface{}`)。举个例子,你可能定义了下述的类型,它们看起来像 `interface{}`,但实际上并不是:
```go
type UserNode interface {}
// the following types implement the UserNode interface.
type (
UserNull struct{}
UserBool struct{ Value bool }
UserInt64 struct{ Value int64 }
UserFloat64 struct{ Value float64 }
UserString struct{ Value string }
UserObject struct{ Value map[string]UserNode }
UserArray struct{ Value []UserNode }
)
```
Sonic 提供了下述的 API 来返回 **“对 JSON AST 的前序遍历”**。`ast.Visitor` 是一个 SAX 风格的接口,这在某些 C++ 的 JSON 解析库中被使用到。你需要自己实现一个 `ast.Visitor`,将它传递给 `ast.Preorder()` 方法。在你的实现中你可以使用自定义的类型来表示 JSON 的值。在你的 `ast.Visitor` 中,可能需要有一个 O(n) 空间复杂度的容器(比如说栈)来记录 object / array 的层级。
```go
func Preorder(str string, visitor Visitor, opts *VisitorOptions) error
type Visitor interface {
OnNull() error
OnBool(v bool) error
OnString(v string) error
OnInt64(v int64, n json.Number) error
OnFloat64(v float64, n json.Number) error
OnObjectBegin(capacity int) error
OnObjectKey(key string) error
OnObjectEnd() error
OnArrayBegin(capacity int) error
OnArrayEnd() error
}
```
详细用法参看 [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go),我们还为 `UserNode` 实现了一个示例 `ast.Visitor`,你可以在 [ast/visitor_test.go](https://github.com/bytedance/sonic/blob/main/ast/visitor_test.go) 中找到它。
## 兼容性
由于开发高性能代码的困难性, Sonic **不**保证对所有环境的支持。对于在不同环境中使用 Sonic 构建应用程序的开发者,我们有以下建议:
@@ -377,6 +416,15 @@ go someFunc(user)
**注意**:由于 `ast.Node` 的惰性加载设计,其**不能**直接保证并发安全性,但你可以调用 `Node.Load()` / `Node.LoadAll()` 来实现并发安全。尽管可能会带来性能损失,但仍比转换成 `map` 或 `interface{}` 更为高效。
### 使用 `ast.Node` 还是 `ast.Visitor`
对于泛型数据的解析,`ast.Node` 在大多数场景上应该能够满足你的需求。
然而,`ast.Node` 是一种针对部分解析 JSON 而设计的泛型容器,它包含一些特殊设计,比如惰性加载,如果你希望像 `Unmarshal()` 那样直接解析整个 JSON这些设计可能并不合适。尽管 `ast.Node` 相较于 `map` 或 `interface{}` 来说是更好的一种泛型容器,但它毕竟也是一种中间表示,如果你的最终类型是自定义的,你还得在解析完成后将上述类型转化成你自定义的类型。
在上述场景中,如果想要有更极致的性能,`ast.Visitor` 会是更好的选择。它采用和 `Unmarshal()` 类似的形式解析 JSON并且你可以直接使用你的最终类型去表示 JSON AST而不需要经过额外的任何中间表示。
但是,`ast.Visitor` 并不是一个很易用的 API。你可能需要写大量的代码去实现自己的 `ast.Visitor`,并且需要在解析过程中仔细维护树的层级。如果你决定要使用这个 API请先仔细阅读 [ast/visitor.go](https://github.com/bytedance/sonic/blob/main/ast/visitor.go) 中的注释。
## 社区
Sonic 是 [CloudWeGo](https://www.cloudwego.io/) 下的一个子项目。我们致力于构建云原生生态系统。

View File

@@ -184,3 +184,8 @@ func Get(src []byte, path ...interface{}) (ast.Node, error) {
func GetFromString(src string, path ...interface{}) (ast.Node, error) {
return ast.NewSearcher(src).GetByPath(path...)
}
// Valid reports whether data is a valid JSON encoding.
func Valid(data []byte) bool {
return ConfigDefault.Valid(data)
}

View File

@@ -1,4 +1,4 @@
// +build amd64,go1.15,!go1.21
// +build amd64,go1.16,!go1.22
/*
* Copyright 2022 ByteDance Inc.
@@ -87,7 +87,13 @@ func encodeBase64(src []byte) string {
func (self *Parser) decodeValue() (val types.JsonState) {
sv := (*rt.GoString)(unsafe.Pointer(&self.s))
self.p = native.Value(sv.Ptr, sv.Len, self.p, &val, 0)
flag := types.F_USE_NUMBER
if self.dbuf != nil {
flag = 0
val.Dbuf = self.dbuf
val.Dcap = types.MaxDigitNums
}
self.p = native.Value(sv.Ptr, sv.Len, self.p, &val, uint64(flag))
return
}

View File

@@ -1,4 +1,4 @@
// +build !amd64 go1.21
// +build !amd64 !go1.16 go1.22
/*
* Copyright 2022 ByteDance Inc.
@@ -27,6 +27,10 @@ import (
`github.com/bytedance/sonic/internal/rt`
)
func init() {
println("WARNING: sonic only supports Go1.16~1.20 && CPU amd64, but your environment is not suitable")
}
func quote(buf *[]byte, val string) {
quoteString(buf, val)
}
@@ -49,7 +53,7 @@ func encodeBase64(src []byte) string {
}
func (self *Parser) decodeValue() (val types.JsonState) {
e, v := decodeValue(self.s, self.p)
e, v := decodeValue(self.s, self.p, self.dbuf == nil)
if e < 0 {
return v
}

View File

@@ -220,7 +220,7 @@ func decodeFloat64(src string, pos int) (ret int, v float64, err error) {
return ret, v, nil
}
func decodeValue(src string, pos int) (ret int, v types.JsonState) {
func decodeValue(src string, pos int, skipnum bool) (ret int, v types.JsonState) {
pos = skipBlank(src, pos)
if pos < 0 {
return pos, types.JsonState{Vt: types.ValueType(pos)}
@@ -256,6 +256,14 @@ func decodeValue(src string, pos int) (ret int, v types.JsonState) {
}
return ret, types.JsonState{Vt: types.V_FALSE}
case '-', '+', '0', '1', '2', '3', '4', '5', '6', '7', '8', '9':
if skipnum {
ret = skipNumber(src, pos)
if ret >= 0 {
return ret, types.JsonState{Vt: types.V_DOUBLE, Iv: 0, Ep: pos}
} else {
return ret, types.JsonState{Vt: types.ValueType(ret)}
}
} else {
var iv int64
ret, iv, _ = decodeInt64(src, pos)
if ret >= 0 {
@@ -270,6 +278,8 @@ func decodeValue(src string, pos int) (ret int, v types.JsonState) {
} else {
return ret, types.JsonState{Vt: types.ValueType(ret)}
}
}
default:
return -int(types.ERR_INVALID_CHAR), types.JsonState{Vt:-types.ValueType(types.ERR_INVALID_CHAR)}
}

View File

@@ -19,8 +19,6 @@ package ast
import (
`sync`
`unicode/utf8`
`github.com/bytedance/sonic/internal/rt`
)
const (
@@ -165,18 +163,18 @@ func (self *Node) encodeFalse(buf *[]byte) error {
}
func (self *Node) encodeNumber(buf *[]byte) error {
str := rt.StrFrom(self.p, self.v)
str := self.toString()
*buf = append(*buf, str...)
return nil
}
func (self *Node) encodeString(buf *[]byte) error {
if self.v == 0 {
if self.l == 0 {
*buf = append(*buf, '"', '"')
return nil
}
quote(buf, rt.StrFrom(self.p, self.v))
quote(buf, self.toString())
return nil
}
@@ -195,16 +193,28 @@ func (self *Node) encodeArray(buf *[]byte) error {
*buf = append(*buf, '[')
var p = (*Node)(self.p)
err := p.encode(buf)
if err != nil {
var s = (*linkedNodes)(self.p)
var started bool
if nb > 0 {
n := s.At(0)
if n.Exists() {
if err := n.encode(buf); err != nil {
return err
}
started = true
}
}
for i := 1; i < nb; i++ {
n := s.At(i)
if !n.Exists() {
continue
}
if started {
*buf = append(*buf, ',')
p = p.unsafe_next()
err := p.encode(buf)
if err != nil {
}
started = true
if err := n.encode(buf); err != nil {
return err
}
}
@@ -240,16 +250,28 @@ func (self *Node) encodeObject(buf *[]byte) error {
*buf = append(*buf, '{')
var p = (*Pair)(self.p)
err := p.encode(buf)
if err != nil {
var s = (*linkedPairs)(self.p)
var started bool
if nb > 0 {
n := s.At(0)
if n.Value.Exists() {
if err := n.encode(buf); err != nil {
return err
}
started = true
}
}
for i := 1; i < nb; i++ {
n := s.At(i)
if !n.Value.Exists() {
continue
}
if started {
*buf = append(*buf, ',')
p = p.unsafe_next()
err := p.encode(buf)
if err != nil {
}
started = true
if err := n.encode(buf); err != nil {
return err
}
}

View File

@@ -8,6 +8,33 @@ import (
`github.com/bytedance/sonic/internal/native/types`
)
func newError(err types.ParsingError, msg string) *Node {
return &Node{
t: V_ERROR,
l: uint(err),
p: unsafe.Pointer(&msg),
}
}
// Error returns error message if the node is invalid
func (self Node) Error() string {
if self.t != V_ERROR {
return ""
} else {
return *(*string)(self.p)
}
}
func newSyntaxError(err SyntaxError) *Node {
msg := err.Description()
return &Node{
t: V_ERROR,
l: uint(err.Code),
p: unsafe.Pointer(&msg),
}
}
func (self *Parser) syntaxError(err types.ParsingError) SyntaxError {
return SyntaxError{
Pos : self.p,
@@ -16,13 +43,18 @@ func (self *Parser) syntaxError(err types.ParsingError) SyntaxError {
}
}
func newSyntaxError(err SyntaxError) *Node {
msg := err.Description()
func unwrapError(err error) *Node {
if se, ok := err.(*Node); ok {
return se
}else if sse, ok := err.(Node); ok {
return &sse
} else {
msg := err.Error()
return &Node{
t: V_ERROR,
v: int64(err.Code),
p: unsafe.Pointer(&msg),
}
}
}
type SyntaxError struct {

View File

@@ -82,26 +82,54 @@ type ObjectIterator struct {
Iterator
}
func (self *ListIterator) next() *Node {
next_start:
if !self.HasNext() {
return nil
} else {
n := self.p.nodeAt(self.i)
self.i++
if !n.Exists() {
goto next_start
}
return n
}
}
// Next scans through children of underlying V_ARRAY,
// copies each child to v, and returns .HasNext().
func (self *ListIterator) Next(v *Node) bool {
if !self.HasNext() {
n := self.next()
if n == nil {
return false
} else {
*v, self.i = *self.p.nodeAt(self.i), self.i + 1
}
*v = *n
return true
}
func (self *ObjectIterator) next() *Pair {
next_start:
if !self.HasNext() {
return nil
} else {
n := self.p.pairAt(self.i)
self.i++
if !n.Value.Exists() {
goto next_start
}
return n
}
}
// Next scans through children of underlying V_OBJECT,
// copies each child to v, and returns .HasNext().
func (self *ObjectIterator) Next(p *Pair) bool {
if !self.HasNext() {
n := self.next()
if n == nil {
return false
} else {
*p, self.i = *self.p.pairAt(self.i), self.i + 1
return true
}
*p = *n
return true
}
// Sequence represents scanning path of single-layer nodes.
@@ -129,36 +157,39 @@ type Scanner func(path Sequence, node *Node) bool
//
// Especailly, if the node is not V_ARRAY or V_OBJECT,
// the node itself will be returned and Sequence.Index == -1.
//
// NOTICE: A unsetted node WON'T trigger sc, but its index still counts into Path.Index
func (self *Node) ForEach(sc Scanner) error {
switch self.itype() {
case types.V_ARRAY:
ns, err := self.UnsafeArray()
iter, err := self.Values()
if err != nil {
return err
}
for i := range ns {
if !sc(Sequence{i, nil}, &ns[i]) {
return err
v := iter.next()
for v != nil {
if !sc(Sequence{iter.i-1, nil}, v) {
return nil
}
v = iter.next()
}
case types.V_OBJECT:
ns, err := self.UnsafeMap()
iter, err := self.Properties()
if err != nil {
return err
}
for i := range ns {
if !sc(Sequence{i, &ns[i].Key}, &ns[i].Value) {
return err
v := iter.next()
for v != nil {
if !sc(Sequence{iter.i-1, &v.Key}, &v.Value) {
return nil
}
v = iter.next()
}
default:
if self.Check() != nil {
return self
}
sc(Sequence{-1, nil}, self)
}
return self.Check()
}
type PairSlice []Pair
func (self PairSlice) Sort() {
radixQsort(self, 0, maxDepth(len(self)))
return nil
}

File diff suppressed because it is too large Load Diff

View File

@@ -18,11 +18,15 @@ package ast
import (
`fmt`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/internal/rt`
)
const _DEFAULT_NODE_CAP int = 16
const (
_DEFAULT_NODE_CAP int = 8
_APPEND_GROW_SHIFT = 1
)
const (
_ERR_NOT_FOUND types.ParsingError = 33
@@ -30,7 +34,10 @@ const (
)
var (
// ErrNotExist means both key and value doesn't exist
ErrNotExist error = newError(_ERR_NOT_FOUND, "value not exists")
// ErrUnsupportType means API on the node is unsupported
ErrUnsupportType error = newError(_ERR_UNSUPPORT_TYPE, "unsupported type")
)
@@ -39,6 +46,7 @@ type Parser struct {
s string
noLazy bool
skipValue bool
dbuf *byte
}
/** Parser Private Methods **/
@@ -107,7 +115,7 @@ func (self *Parser) lspace(sp int) int {
return sp
}
func (self *Parser) decodeArray(ret []Node) (Node, types.ParsingError) {
func (self *Parser) decodeArray(ret *linkedNodes) (Node, types.ParsingError) {
sp := self.p
ns := len(self.s)
@@ -119,7 +127,7 @@ func (self *Parser) decodeArray(ret []Node) (Node, types.ParsingError) {
/* check for empty array */
if self.s[self.p] == ']' {
self.p++
return emptyArrayNode, 0
return Node{t: types.V_ARRAY}, 0
}
/* allocate array space and parse every element */
@@ -149,7 +157,7 @@ func (self *Parser) decodeArray(ret []Node) (Node, types.ParsingError) {
}
/* add the value to result */
ret = append(ret, val)
ret.Add(val)
self.p = self.lspace(self.p)
/* check for EOF */
@@ -160,17 +168,17 @@ func (self *Parser) decodeArray(ret []Node) (Node, types.ParsingError) {
/* check for the next character */
switch self.s[self.p] {
case ',' : self.p++
case ']' : self.p++; return NewArray(ret), 0
case ']' : self.p++; return newArray(ret), 0
default:
if val.isLazy() {
return newLazyArray(self, ret), 0
}
// if val.isLazy() {
// return newLazyArray(self, ret), 0
// }
return Node{}, types.ERR_INVALID_CHAR
}
}
}
func (self *Parser) decodeObject(ret []Pair) (Node, types.ParsingError) {
func (self *Parser) decodeObject(ret *linkedPairs) (Node, types.ParsingError) {
sp := self.p
ns := len(self.s)
@@ -182,7 +190,7 @@ func (self *Parser) decodeObject(ret []Pair) (Node, types.ParsingError) {
/* check for empty object */
if self.s[self.p] == '}' {
self.p++
return emptyObjectNode, 0
return Node{t: types.V_OBJECT}, 0
}
/* decode each pair */
@@ -235,7 +243,8 @@ func (self *Parser) decodeObject(ret []Pair) (Node, types.ParsingError) {
}
/* add the value to result */
ret = append(ret, Pair{Key: key, Value: val})
// FIXME: ret's address may change here, thus previous referred node in ret may be invalid !!
ret.Add(Pair{Key: key, Value: val})
self.p = self.lspace(self.p)
/* check for EOF */
@@ -246,11 +255,11 @@ func (self *Parser) decodeObject(ret []Pair) (Node, types.ParsingError) {
/* check for the next character */
switch self.s[self.p] {
case ',' : self.p++
case '}' : self.p++; return NewObject(ret), 0
case '}' : self.p++; return newObject(ret), 0
default:
if val.isLazy() {
return newLazyObject(self, ret), 0
}
// if val.isLazy() {
// return newLazyObject(self, ret), 0
// }
return Node{}, types.ERR_INVALID_CHAR
}
}
@@ -290,15 +299,23 @@ func (self *Parser) Parse() (Node, types.ParsingError) {
case types.V_FALSE : return falseNode, 0
case types.V_STRING : return self.decodeString(val.Iv, val.Ep)
case types.V_ARRAY:
if self.noLazy {
return self.decodeArray(make([]Node, 0, _DEFAULT_NODE_CAP))
if p := skipBlank(self.s, self.p); p >= self.p && self.s[p] == ']' {
self.p = p + 1
return Node{t: types.V_ARRAY}, 0
}
return newLazyArray(self, make([]Node, 0, _DEFAULT_NODE_CAP)), 0
if self.noLazy {
return self.decodeArray(new(linkedNodes))
}
return newLazyArray(self), 0
case types.V_OBJECT:
if self.noLazy {
return self.decodeObject(make([]Pair, 0, _DEFAULT_NODE_CAP))
if p := skipBlank(self.s, self.p); p >= self.p && self.s[p] == '}' {
self.p = p + 1
return Node{t: types.V_OBJECT}, 0
}
return newLazyObject(self, make([]Pair, 0, _DEFAULT_NODE_CAP)), 0
if self.noLazy {
return self.decodeObject(new(linkedPairs))
}
return newLazyObject(self), 0
case types.V_DOUBLE : return NewNumber(self.s[val.Ep:self.p]), 0
case types.V_INTEGER : return NewNumber(self.s[val.Ep:self.p]), 0
default : return Node{}, types.ParsingError(-val.Vt)
@@ -429,7 +446,7 @@ func (self *Node) skipNextNode() *Node {
}
parser, stack := self.getParserAndArrayStack()
ret := stack.v
ret := &stack.v
sp := parser.p
ns := len(parser.s)
@@ -458,7 +475,8 @@ func (self *Node) skipNextNode() *Node {
}
/* add the value to result */
ret = append(ret, val)
ret.Add(val)
self.l++
parser.p = parser.lspace(parser.p)
/* check for EOF */
@@ -470,12 +488,11 @@ func (self *Node) skipNextNode() *Node {
switch parser.s[parser.p] {
case ',':
parser.p++
self.setLazyArray(parser, ret)
return &ret[len(ret)-1]
return ret.At(ret.Len()-1)
case ']':
parser.p++
self.setArray(ret)
return &ret[len(ret)-1]
return ret.At(ret.Len()-1)
default:
return newSyntaxError(parser.syntaxError(types.ERR_INVALID_CHAR))
}
@@ -487,7 +504,7 @@ func (self *Node) skipNextPair() (*Pair) {
}
parser, stack := self.getParserAndObjectStack()
ret := stack.v
ret := &stack.v
sp := parser.p
ns := len(parser.s)
@@ -541,7 +558,8 @@ func (self *Node) skipNextPair() (*Pair) {
}
/* add the value to result */
ret = append(ret, Pair{Key: key, Value: val})
ret.Add(Pair{Key: key, Value: val})
self.l++
parser.p = parser.lspace(parser.p)
/* check for EOF */
@@ -553,12 +571,11 @@ func (self *Node) skipNextPair() (*Pair) {
switch parser.s[parser.p] {
case ',':
parser.p++
self.setLazyObject(parser, ret)
return &ret[len(ret)-1]
return ret.At(ret.Len()-1)
case '}':
parser.p++
self.setObject(ret)
return &ret[len(ret)-1]
return ret.At(ret.Len()-1)
default:
return &Pair{key, *newSyntaxError(parser.syntaxError(types.ERR_INVALID_CHAR))}
}
@@ -601,10 +618,30 @@ func LoadsUseNumber(src string) (int, interface{}, error) {
}
}
// NewParser returns pointer of new allocated parser
func NewParser(src string) *Parser {
return &Parser{s: src}
}
// NewParser returns new allocated parser
func NewParserObj(src string) Parser {
return Parser{s: src}
}
// decodeNumber controls if parser decodes the number values instead of skip them
// WARN: once you set decodeNumber(true), please set decodeNumber(false) before you drop the parser
// otherwise the memory CANNOT be reused
func (self *Parser) decodeNumber(decode bool) {
if !decode && self.dbuf != nil {
types.FreeDbuf(self.dbuf)
self.dbuf = nil
return
}
if decode && self.dbuf == nil {
self.dbuf = types.NewDbuf()
}
}
// ExportError converts types.ParsingError to std Error
func (self *Parser) ExportError(err types.ParsingError) error {
if err == _ERR_NOT_FOUND {

View File

@@ -1,206 +0,0 @@
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package ast
// Algorithm 3-way Radix Quicksort, d means the radix.
// Reference: https://algs4.cs.princeton.edu/51radix/Quick3string.java.html
func radixQsort(kvs PairSlice, d, maxDepth int) {
for len(kvs) > 11 {
// To avoid the worst case of quickSort (time: O(n^2)), use introsort here.
// Reference: https://en.wikipedia.org/wiki/Introsort and
// https://github.com/golang/go/issues/467
if maxDepth == 0 {
heapSort(kvs, 0, len(kvs))
return
}
maxDepth--
p := pivot(kvs, d)
lt, i, gt := 0, 0, len(kvs)
for i < gt {
c := byteAt(kvs[i].Key, d)
if c < p {
swap(kvs, lt, i)
i++
lt++
} else if c > p {
gt--
swap(kvs, i, gt)
} else {
i++
}
}
// kvs[0:lt] < v = kvs[lt:gt] < kvs[gt:len(kvs)]
// Native implemention:
// radixQsort(kvs[:lt], d, maxDepth)
// if p > -1 {
// radixQsort(kvs[lt:gt], d+1, maxDepth)
// }
// radixQsort(kvs[gt:], d, maxDepth)
// Optimize as follows: make recursive calls only for the smaller parts.
// Reference: https://www.geeksforgeeks.org/quicksort-tail-call-optimization-reducing-worst-case-space-log-n/
if p == -1 {
if lt > len(kvs) - gt {
radixQsort(kvs[gt:], d, maxDepth)
kvs = kvs[:lt]
} else {
radixQsort(kvs[:lt], d, maxDepth)
kvs = kvs[gt:]
}
} else {
ml := maxThree(lt, gt-lt, len(kvs)-gt)
if ml == lt {
radixQsort(kvs[lt:gt], d+1, maxDepth)
radixQsort(kvs[gt:], d, maxDepth)
kvs = kvs[:lt]
} else if ml == gt-lt {
radixQsort(kvs[:lt], d, maxDepth)
radixQsort(kvs[gt:], d, maxDepth)
kvs = kvs[lt:gt]
d += 1
} else {
radixQsort(kvs[:lt], d, maxDepth)
radixQsort(kvs[lt:gt], d+1, maxDepth)
kvs = kvs[gt:]
}
}
}
insertRadixSort(kvs, d)
}
func insertRadixSort(kvs PairSlice, d int) {
for i := 1; i < len(kvs); i++ {
for j := i; j > 0 && lessFrom(kvs[j].Key, kvs[j-1].Key, d); j-- {
swap(kvs, j, j-1)
}
}
}
func pivot(kvs PairSlice, d int) int {
m := len(kvs) >> 1
if len(kvs) > 40 {
// Tukey's ``Ninther,'' median of three mediankvs of three.
t := len(kvs) / 8
return medianThree(
medianThree(byteAt(kvs[0].Key, d), byteAt(kvs[t].Key, d), byteAt(kvs[2*t].Key, d)),
medianThree(byteAt(kvs[m].Key, d), byteAt(kvs[m-t].Key, d), byteAt(kvs[m+t].Key, d)),
medianThree(byteAt(kvs[len(kvs)-1].Key, d),
byteAt(kvs[len(kvs)-1-t].Key, d),
byteAt(kvs[len(kvs)-1-2*t].Key, d)))
}
return medianThree(byteAt(kvs[0].Key, d), byteAt(kvs[m].Key, d), byteAt(kvs[len(kvs)-1].Key, d))
}
func medianThree(i, j, k int) int {
if i > j {
i, j = j, i
} // i < j
if k < i {
return i
}
if k > j {
return j
}
return k
}
func maxThree(i, j, k int) int {
max := i
if max < j {
max = j
}
if max < k {
max = k
}
return max
}
// maxDepth returns a threshold at which quicksort should switch
// to heapsort. It returnkvs 2*ceil(lg(n+1)).
func maxDepth(n int) int {
var depth int
for i := n; i > 0; i >>= 1 {
depth++
}
return depth * 2
}
// siftDown implements the heap property on kvs[lo:hi].
// first is an offset into the array where the root of the heap lies.
func siftDown(kvs PairSlice, lo, hi, first int) {
root := lo
for {
child := 2*root + 1
if child >= hi {
break
}
if child+1 < hi && kvs[first+child].Key < kvs[first+child+1].Key {
child++
}
if kvs[first+root].Key >= kvs[first+child].Key {
return
}
swap(kvs, first+root, first+child)
root = child
}
}
func heapSort(kvs PairSlice, a, b int) {
first := a
lo := 0
hi := b - a
// Build heap with the greatest element at top.
for i := (hi - 1) / 2; i >= 0; i-- {
siftDown(kvs, i, hi, first)
}
// Pop elements, the largest first, into end of kvs.
for i := hi - 1; i >= 0; i-- {
swap(kvs, first, first+i)
siftDown(kvs, lo, i, first)
}
}
// Note that Pair.Key is NOT pointed to Pair.m when map key is integer after swap
func swap(kvs PairSlice, a, b int) {
kvs[a].Key, kvs[b].Key = kvs[b].Key, kvs[a].Key
kvs[a].Value, kvs[b].Value = kvs[b].Value, kvs[a].Value
}
// Compare two strings from the pos d.
func lessFrom(a, b string, d int) bool {
l := len(a)
if l > len(b) {
l = len(b)
}
for i := d; i < l; i++ {
if a[i] == b[i] {
continue
}
return a[i] < b[i]
}
return len(a) < len(b)
}
func byteAt(b string, p int) int {
if p < len(b) {
return int(b[p])
}
return -1
}

View File

@@ -1,14 +0,0 @@
#!/usr/bin/env bash
pwd=$(pwd)
export SONIC_NO_ASYNC_GC=1
cd $pwd/ast
go test -benchmem -run=^$ -benchtime=1000000x -bench "^(BenchmarkGet.*|BenchmarkSet.*)$"
go test -benchmem -run=^$ -benchtime=10000x -bench "^(BenchmarkParser_.*|BenchmarkEncode.*)$"
go test -benchmem -run=^$ -benchtime=10000000x -bench "^(BenchmarkNodeGetByPath|BenchmarkStructGetByPath|BenchmarkNodeIndex|BenchmarkStructIndex|BenchmarkSliceIndex|BenchmarkMapIndex|BenchmarkNodeGet|BenchmarkSliceGet|BenchmarkMapGet|BenchmarkNodeSet|BenchmarkMapSet|BenchmarkNodeSetByIndex|BenchmarkSliceSetByIndex|BenchmarkStructSetByIndex|BenchmarkNodeUnset|BenchmarkMapUnset|BenchmarkNodUnsetByIndex|BenchmarkSliceUnsetByIndex|BenchmarkNodeAdd|BenchmarkSliceAdd|BenchmarkMapAdd)$"
unset SONIC_NO_ASYNC_GC
cd $pwd

View File

@@ -1,134 +0,0 @@
#!/usr/bin/env python3
# Copyright 2022 ByteDance Inc.
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import tempfile
import os
import subprocess
import argparse
gbench_prefix = "SONIC_NO_ASYNC_GC=1 go test -benchmem -run=none "
def run(cmd):
print(cmd)
if os.system(cmd):
print ("Failed to run cmd: %s"%(cmd))
exit(1)
def run_s(cmd):
print (cmd)
try:
res = os.popen(cmd)
except subprocess.CalledProcessError as e:
if e.returncode:
print (e.output)
exit(1)
return res.read()
def run_r(cmd):
print (cmd)
try:
cmds = cmd.split(' ')
data = subprocess.check_output(cmds, stderr=subprocess.STDOUT)
except subprocess.CalledProcessError as e:
if e.returncode:
print (e.output)
exit(1)
return data.decode("utf-8")
def compare(args):
# detech current branch.
# result = run_r("git branch")
current_branch = run_s("git status | head -n1 | sed 's/On branch //'")
# for br in result.split('\n'):
# if br.startswith("* "):
# current_branch = br.lstrip('* ')
# break
if not current_branch:
print ("Failed to detech current branch")
return None
# get the current diff
(fd, diff) = tempfile.mkstemp()
run("git diff > %s"%diff)
# early return if currrent is main branch.
print ("Current branch: %s"%(current_branch))
if current_branch == "main":
print ("Cannot compare at the main branch.Please build a new branch")
return None
# benchmark current branch
(fd, target) = tempfile.mkstemp(".target.txt")
run("%s %s ./... 2>&1 | tee %s" %(gbench_prefix, args, target))
# trying to switch to the latest main branch
run("git checkout -- .")
if current_branch != "main":
run("git checkout main")
run("git pull --allow-unrelated-histories origin main")
# benchmark main branch
(fd, main) = tempfile.mkstemp(".main.txt")
run("%s %s ./... 2>&1 | tee %s" %(gbench_prefix, args, main))
# diff the result
# benchstat = "go get golang.org/x/perf/cmd/benchstat && go install golang.org/x/perf/cmd/benchstat"
run( "benchstat -sort=delta %s %s"%(main, target))
run("git checkout -- .")
# restore branch
if current_branch != "main":
run("git checkout %s"%(current_branch))
run("patch -p1 < %s" % (diff))
return target
def main():
argparser = argparse.ArgumentParser(description='Tools to test the performance. Example: ./bench.py -b Decoder_Generic_Sonic -c')
argparser.add_argument('-b', '--bench', dest='filter', required=False,
help='Specify the filter for golang benchmark')
argparser.add_argument('-c', '--compare', dest='compare', action='store_true', required=False,
help='Compare with the main benchmarking')
argparser.add_argument('-t', '--times', dest='times', required=False,
help='benchmark the times')
argparser.add_argument('-r', '--repeat_times', dest='count', required=False,
help='benchmark the count')
args = argparser.parse_args()
if args.filter:
gbench_args = "-bench=%s"%(args.filter)
else:
gbench_args = "-bench=."
if args.times:
gbench_args += " -benchtime=%s"%(args.times)
if args.count:
gbench_args += " -count=%s"%(args.count)
else:
gbench_args += " -count=10"
if args.compare:
target = compare(gbench_args)
else:
target = None
if not target:
(fd, target) = tempfile.mkstemp(".target.txt")
run("%s %s ./... 2>&1 | tee %s" %(gbench_prefix, gbench_args, target))
if __name__ == "__main__":
main()

View File

@@ -1,27 +0,0 @@
#!/usr/bin/env bash
pwd=$(pwd)
export SONIC_NO_ASYNC_GC=1
cd $pwd/encoder
go test -benchmem -run=^$ -benchtime=100000x -bench "^(BenchmarkEncoder_.*)$"
cd $pwd/decoder
go test -benchmem -run=^$ -benchtime=100000x -bench "^(BenchmarkDecoder_.*)$"
cd $pwd/ast
go test -benchmem -run=^$ -benchtime=1000000x -bench "^(BenchmarkGet.*|BenchmarkSet.*)$"
go test -benchmem -run=^$ -benchtime=10000x -bench "^(BenchmarkParser_.*|BenchmarkEncode.*)$"
go test -benchmem -run=^$ -benchtime=10000000x -bench "^(BenchmarkNodeGetByPath|BenchmarkStructGetByPath|BenchmarkNodeIndex|BenchmarkStructIndex|BenchmarkSliceIndex|BenchmarkMapIndex|BenchmarkNodeGet|BenchmarkSliceGet|BenchmarkMapGet|BenchmarkNodeSet|BenchmarkMapSet|BenchmarkNodeSetByIndex|BenchmarkSliceSetByIndex|BenchmarkStructSetByIndex|BenchmarkNodeUnset|BenchmarkMapUnset|BenchmarkNodUnsetByIndex|BenchmarkSliceUnsetByIndex|BenchmarkNodeAdd|BenchmarkSliceAdd|BenchmarkMapAdd)$"
cd $pwd/external_jsonlib_test/benchmark_test
go test -benchmem -run=^$ -benchtime=100000x -bench "^(BenchmarkEncoder_.*|BenchmarkDecoder_.*)$"
go test -benchmem -run=^$ -benchtime=1000000x -bench "^(BenchmarkGet.*|BenchmarkSet.*)$"
go test -benchmem -run=^$ -benchtime=10000x -bench "^(BenchmarkParser_.*)$"
unset SONIC_NO_ASYNC_GC
cd $pwd

View File

@@ -1,10 +0,0 @@
#!/usr/bin/env bash
current=$(git status | head -n1 | sed 's/On branch //')
name=${1:-$current}
if [[ ! $name =~ ^(((opt(imize)?|feat(ure)?|doc|(bug|hot)?fix|test|refact(or)?|ci)/.+)|(main|develop)|(release/.+)|(release-v[0-9]+\.[0-9]+)|(release/v[0-9]+\.[0-9]+\.[0-9]+(-[a-z0-9.]+(\+[a-z0-9.]+)?)?)|revert-[a-z0-9]+)$ ]]; then
echo "branch name '$name' is invalid"
exit 1
else
echo "branch name '$name' is valid"
fi

View File

@@ -1,4 +1,4 @@
// +build !amd64 go1.21
// +build !amd64 !go1.16 go1.22
/*
* Copyright 2021 ByteDance Inc.

View File

@@ -1,4 +1,4 @@
// +build amd64,go1.15,!go1.21
// +build amd64,go1.16,!go1.22
/*
* Copyright 2023 ByteDance Inc.
@@ -25,6 +25,10 @@ import (
// Decoder is the decoder context object
type Decoder = decoder.Decoder
// SyntaxError represents json syntax error
type SyntaxError = decoder.SyntaxError
// MismatchTypeError represents dismatching between json and object
type MismatchTypeError = decoder.MismatchTypeError
// Options for decode.
@@ -42,8 +46,6 @@ const (
// StreamDecoder is the decoder context object for streaming input.
type StreamDecoder = decoder.StreamDecoder
type SyntaxError = decoder.SyntaxError
var (
// NewDecoder creates a new decoder instance.
NewDecoder = decoder.NewDecoder

View File

@@ -1,4 +1,4 @@
// +build !amd64 go1.21
// +build !amd64 !go1.16 go1.22
/*
* Copyright 2023 ByteDance Inc.
@@ -14,28 +14,34 @@
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
*/
package decoder
import (
`encoding/json`
`bytes`
`encoding/json`
`io`
`reflect`
`unsafe`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/option`
`io`
)
const (
_F_use_int64 = iota
_F_use_number
_F_disable_urc
_F_disable_unknown
_F_copy_string
_F_validate_string
func init() {
println("WARNING: sonic only supports Go1.16~1.20 && CPU amd64, but your environment is not suitable")
}
_F_allow_control = 31
const (
_F_use_int64 = 0
_F_disable_urc = 2
_F_disable_unknown = 3
_F_copy_string = 4
_F_use_number = types.B_USE_NUMBER
_F_validate_string = types.B_VALIDATE_STRING
_F_allow_control = types.B_ALLOW_CONTROL
)
type Options uint64
@@ -163,34 +169,26 @@ func Pretouch(vt reflect.Type, opts ...option.CompileOption) error {
return nil
}
type StreamDecoder struct {
r io.Reader
buf []byte
scanp int
scanned int64
err error
Decoder
}
type StreamDecoder = json.Decoder
// NewStreamDecoder adapts to encoding/json.NewDecoder API.
//
// NewStreamDecoder returns a new decoder that reads from r.
func NewStreamDecoder(r io.Reader) *StreamDecoder {
return &StreamDecoder{r : r}
return json.NewDecoder(r)
}
// Decode decodes input stream into val with corresponding data.
// Redundantly bytes may be read and left in its buffer, and can be used at next call.
// Either io error from underlying io.Reader (except io.EOF)
// or syntax error from data will be recorded and stop subsequently decoding.
func (self *StreamDecoder) Decode(val interface{}) (err error) {
dec := json.NewDecoder(self.r)
if (self.f | uint64(OptionUseNumber)) != 0 {
dec.UseNumber()
}
if (self.f | uint64(OptionDisableUnknown)) != 0 {
dec.DisallowUnknownFields()
}
return dec.Decode(val)
// SyntaxError represents json syntax error
type SyntaxError json.SyntaxError
// Description
func (s SyntaxError) Description() string {
return (*json.SyntaxError)(unsafe.Pointer(&s)).Error()
}
// Error
func (s SyntaxError) Error() string {
return (*json.SyntaxError)(unsafe.Pointer(&s)).Error()
}
// MismatchTypeError represents dismatching between json and object
type MismatchTypeError json.UnmarshalTypeError

View File

@@ -1,4 +1,4 @@
// +build amd64,go1.15,!go1.21
// +build amd64,go1.16,!go1.22
/*
* Copyright 2023 ByteDance Inc.

View File

@@ -1,4 +1,4 @@
// +build !amd64 go1.21
// +build !amd64 !go1.16 go1.22
/*
* Copyright 2023 ByteDance Inc.
@@ -27,6 +27,10 @@ import (
`github.com/bytedance/sonic/option`
)
func init() {
println("WARNING: sonic only supports Go1.16~1.20 && CPU amd64, but your environment is not suitable")
}
// Options is a set of encoding options.
type Options uint64
@@ -212,23 +216,12 @@ func Valid(data []byte) (ok bool, start int) {
}
// StreamEncoder uses io.Writer as
type StreamEncoder struct {
w io.Writer
Encoder
}
type StreamEncoder = json.Encoder
// NewStreamEncoder adapts to encoding/json.NewDecoder API.
//
// NewStreamEncoder returns a new encoder that write to w.
func NewStreamEncoder(w io.Writer) *StreamEncoder {
return &StreamEncoder{w: w}
return json.NewEncoder(w)
}
// Encode encodes interface{} as JSON to io.Writer
func (enc *StreamEncoder) Encode(val interface{}) (err error) {
jenc := json.NewEncoder(enc.w)
jenc.SetEscapeHTML((enc.Opts & EscapeHTML) != 0)
jenc.SetIndent(enc.prefix, enc.indent)
err = jenc.Encode(val)
return err
}

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -30,14 +30,14 @@ import (
)
const (
_F_use_int64 = iota
_F_use_number
_F_disable_urc
_F_disable_unknown
_F_copy_string
_F_validate_string
_F_use_int64 = 0
_F_disable_urc = 2
_F_disable_unknown = 3
_F_copy_string = 4
_F_allow_control = 31
_F_use_number = types.B_USE_NUMBER
_F_validate_string = types.B_VALIDATE_STRING
_F_allow_control = types.B_ALLOW_CONTROL
)
type Options uint64

View File

@@ -44,35 +44,12 @@ func (self SyntaxError) Description() string {
}
func (self SyntaxError) description() string {
i := 16
p := self.Pos - i
q := self.Pos + i
/* check for empty source */
if self.Src == "" {
return fmt.Sprintf("no sources available: %#v", self)
}
/* prevent slicing before the beginning */
if p < 0 {
p, q, i = 0, q - p, i + p
}
/* prevent slicing beyond the end */
if n := len(self.Src); q > n {
n = q - n
q = len(self.Src)
/* move the left bound if possible */
if p > n {
i += n
p -= n
}
}
/* left and right length */
x := clamp_zero(i)
y := clamp_zero(q - p - i - 1)
p, x, q, y := calcBounds(len(self.Src), self.Pos)
/* compose the error description */
return fmt.Sprintf(
@@ -85,6 +62,39 @@ func (self SyntaxError) description() string {
)
}
func calcBounds(size int, pos int) (lbound int, lwidth int, rbound int, rwidth int) {
if pos >= size || pos < 0 {
return 0, 0, size, 0
}
i := 16
lbound = pos - i
rbound = pos + i
/* prevent slicing before the beginning */
if lbound < 0 {
lbound, rbound, i = 0, rbound - lbound, i + lbound
}
/* prevent slicing beyond the end */
if n := size; rbound > n {
n = rbound - n
rbound = size
/* move the left bound if possible */
if lbound > n {
i += n
lbound -= n
}
}
/* left and right length */
lwidth = clamp_zero(i)
rwidth = clamp_zero(rbound - lbound - i - 1)
return
}
func (self SyntaxError) Message() string {
if self.Msg == "" {
return self.Code.Message()
@@ -107,16 +117,19 @@ var stackOverflow = &json.UnsupportedValueError {
Value : reflect.ValueOf("..."),
}
//go:nosplit
func error_wrap(src string, pos int, code types.ParsingError) error {
return SyntaxError {
return *error_wrap_heap(src, pos, code)
}
//go:noinline
func error_wrap_heap(src string, pos int, code types.ParsingError) *SyntaxError {
return &SyntaxError {
Pos : pos,
Src : src,
Code : code,
}
}
//go:nosplit
func error_type(vt *rt.GoType) error {
return &json.UnmarshalTypeError{Type: vt.Pack()}
}
@@ -158,7 +171,6 @@ func (self MismatchTypeError) Description() string {
return fmt.Sprintf("Mismatch type %s with value %s %s", self.Type.String(), swithchJSONType(self.Src, self.Pos), se.description())
}
//go:nosplit
func error_mismatch(src string, pos int, vt *rt.GoType) error {
return &MismatchTypeError {
Pos : pos,
@@ -167,12 +179,10 @@ func error_mismatch(src string, pos int, vt *rt.GoType) error {
}
}
//go:nosplit
func error_field(name string) error {
return errors.New("json: unknown field " + strconv.Quote(name))
}
//go:nosplit
func error_value(value string, vtype reflect.Type) error {
return &json.UnmarshalTypeError {
Type : vtype,

View File

@@ -1,776 +0,0 @@
// +build go1.15,!go1.17
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package decoder
import (
`encoding/json`
`fmt`
`reflect`
`strconv`
`github.com/bytedance/sonic/internal/jit`
`github.com/bytedance/sonic/internal/native`
`github.com/bytedance/sonic/internal/native/types`
`github.com/twitchyliquid64/golang-asm/obj`
`github.com/twitchyliquid64/golang-asm/obj/x86`
)
/** Crucial Registers:
*
* ST(BX) : ro, decoder stack
* DF(R10) : ro, decoder flags
* EP(R11) : wo, error pointer
* IP(R12) : ro, input pointer
* IL(R13) : ro, input length
* IC(R14) : rw, input cursor
* VP(R15) : ro, value pointer (to an interface{})
*/
const (
_VD_args = 8 // 8 bytes for passing arguments to this functions
_VD_fargs = 64 // 64 bytes for passing arguments to other Go functions
_VD_saves = 40 // 40 bytes for saving the registers before CALL instructions
_VD_locals = 88 // 88 bytes for local variables
)
const (
_VD_offs = _VD_fargs + _VD_saves + _VD_locals
_VD_size = _VD_offs + 8 // 8 bytes for the parent frame pointer
)
var (
_VAR_ss = _VAR_ss_Vt
_VAR_df = jit.Ptr(_SP, _VD_fargs + _VD_saves)
)
var (
_VAR_ss_Vt = jit.Ptr(_SP, _VD_fargs + _VD_saves + 8)
_VAR_ss_Dv = jit.Ptr(_SP, _VD_fargs + _VD_saves + 16)
_VAR_ss_Iv = jit.Ptr(_SP, _VD_fargs + _VD_saves + 24)
_VAR_ss_Ep = jit.Ptr(_SP, _VD_fargs + _VD_saves + 32)
_VAR_ss_Db = jit.Ptr(_SP, _VD_fargs + _VD_saves + 40)
_VAR_ss_Dc = jit.Ptr(_SP, _VD_fargs + _VD_saves + 48)
)
var (
_VAR_cs_LR = jit.Ptr(_SP, _VD_fargs + _VD_saves + 56)
_VAR_cs_p = jit.Ptr(_SP, _VD_fargs + _VD_saves + 64)
_VAR_cs_n = jit.Ptr(_SP, _VD_fargs + _VD_saves + 72)
_VAR_cs_d = jit.Ptr(_SP, _VD_fargs + _VD_saves + 80)
)
type _ValueDecoder struct {
jit.BaseAssembler
}
func (self *_ValueDecoder) build() uintptr {
self.Init(self.compile)
return *(*uintptr)(self.Load("decode_value", _VD_size, _VD_args, argPtrs_generic, localPtrs_generic))
}
/** Function Calling Helpers **/
func (self *_ValueDecoder) save(r ...obj.Addr) {
for i, v := range r {
if i > _VD_saves / 8 - 1 {
panic("too many registers to save")
} else {
self.Emit("MOVQ", v, jit.Ptr(_SP, _VD_fargs + int64(i) * 8))
}
}
}
func (self *_ValueDecoder) load(r ...obj.Addr) {
for i, v := range r {
if i > _VD_saves / 8 - 1 {
panic("too many registers to load")
} else {
self.Emit("MOVQ", jit.Ptr(_SP, _VD_fargs + int64(i) * 8), v)
}
}
}
func (self *_ValueDecoder) call(fn obj.Addr) {
self.Emit("MOVQ", fn, _AX) // MOVQ ${fn}, AX
self.Rjmp("CALL", _AX) // CALL AX
}
func (self *_ValueDecoder) call_go(fn obj.Addr) {
self.save(_REG_go...) // SAVE $REG_go
self.call(fn) // CALL ${fn}
self.load(_REG_go...) // LOAD $REG_go
}
/** Decoder Assembler **/
const (
_S_val = iota + 1
_S_arr
_S_arr_0
_S_obj
_S_obj_0
_S_obj_delim
_S_obj_sep
)
const (
_S_omask_key = (1 << _S_obj_0) | (1 << _S_obj_sep)
_S_omask_end = (1 << _S_obj_0) | (1 << _S_obj)
_S_vmask = (1 << _S_val) | (1 << _S_arr_0)
)
const (
_A_init_len = 1
_A_init_cap = 16
)
const (
_ST_Sp = 0
_ST_Vt = _PtrBytes
_ST_Vp = _PtrBytes * (types.MAX_RECURSE + 1)
)
var (
_V_true = jit.Imm(int64(pbool(true)))
_V_false = jit.Imm(int64(pbool(false)))
_F_value = jit.Imm(int64(native.S_value))
)
var (
_V_max = jit.Imm(int64(types.V_MAX))
_E_eof = jit.Imm(int64(types.ERR_EOF))
_E_invalid = jit.Imm(int64(types.ERR_INVALID_CHAR))
_E_recurse = jit.Imm(int64(types.ERR_RECURSE_EXCEED_MAX))
)
var (
_F_convTslice = jit.Func(convTslice)
_F_convTstring = jit.Func(convTstring)
_F_invalid_vtype = jit.Func(invalid_vtype)
)
var (
_T_map = jit.Type(reflect.TypeOf((map[string]interface{})(nil)))
_T_bool = jit.Type(reflect.TypeOf(false))
_T_int64 = jit.Type(reflect.TypeOf(int64(0)))
_T_eface = jit.Type(reflect.TypeOf((*interface{})(nil)).Elem())
_T_slice = jit.Type(reflect.TypeOf(([]interface{})(nil)))
_T_string = jit.Type(reflect.TypeOf(""))
_T_number = jit.Type(reflect.TypeOf(json.Number("")))
_T_float64 = jit.Type(reflect.TypeOf(float64(0)))
)
var _R_tab = map[int]string {
'[': "_decode_V_ARRAY",
'{': "_decode_V_OBJECT",
':': "_decode_V_KEY_SEP",
',': "_decode_V_ELEM_SEP",
']': "_decode_V_ARRAY_END",
'}': "_decode_V_OBJECT_END",
}
func (self *_ValueDecoder) compile() {
self.Emit("SUBQ", jit.Imm(_VD_size), _SP) // SUBQ $_VD_size, SP
self.Emit("MOVQ", _BP, jit.Ptr(_SP, _VD_offs)) // MOVQ BP, _VD_offs(SP)
self.Emit("LEAQ", jit.Ptr(_SP, _VD_offs), _BP) // LEAQ _VD_offs(SP), BP
/* initialize the state machine */
self.Emit("XORL", _CX, _CX) // XORL CX, CX
self.Emit("MOVQ", _DF, _VAR_df) // MOVQ DF, df
/* initialize digital buffer first */
self.Emit("MOVQ", jit.Imm(_MaxDigitNums), _VAR_ss_Dc) // MOVQ $_MaxDigitNums, ss.Dcap
self.Emit("LEAQ", jit.Ptr(_ST, _DbufOffset), _AX) // LEAQ _DbufOffset(ST), AX
self.Emit("MOVQ", _AX, _VAR_ss_Db) // MOVQ AX, ss.Dbuf
/* add ST offset */
self.Emit("ADDQ", jit.Imm(_FsmOffset), _ST) // ADDQ _FsmOffset, _ST
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.WriteRecNotAX(0, _VP, jit.Ptr(_ST, _ST_Vp), false) // MOVQ VP, ST.Vp[0]
self.Emit("MOVQ", jit.Imm(_S_val), jit.Ptr(_ST, _ST_Vt)) // MOVQ _S_val, ST.Vt[0]
self.Sjmp("JMP" , "_next") // JMP _next
/* set the value from previous round */
self.Link("_set_value") // _set_value:
self.Emit("MOVL" , jit.Imm(_S_vmask), _DX) // MOVL _S_vmask, DX
self.Emit("MOVQ" , jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ" , jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX) // BTQ AX, DX
self.Sjmp("JNC" , "_vtype_error") // JNC _vtype_error
self.Emit("XORL" , _SI, _SI) // XORL SI, SI
self.Emit("SUBQ" , jit.Imm(1), jit.Ptr(_ST, _ST_Sp)) // SUBQ $1, ST.Sp
self.Emit("XCHGQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // XCHGQ ST.Vp[CX], SI
self.Emit("MOVQ" , _R8, jit.Ptr(_SI, 0)) // MOVQ R8, (SI)
self.WriteRecNotAX(1, _R9, jit.Ptr(_SI, 8), false) // MOVQ R9, 8(SI)
/* check for value stack */
self.Link("_next") // _next:
self.Emit("MOVQ" , jit.Ptr(_ST, _ST_Sp), _AX) // MOVQ ST.Sp, AX
self.Emit("TESTQ", _AX, _AX) // TESTQ AX, AX
self.Sjmp("JS" , "_return") // JS _return
/* fast path: test up to 4 characters manually */
self.Emit("CMPQ" , _IC, _IL) // CMPQ IC, IL
self.Sjmp("JAE" , "_decode_V_EOF") // JAE _decode_V_EOF
self.Emit("MOVBQZX", jit.Sib(_IP, _IC, 1, 0), _AX) // MOVBQZX (IP)(IC), AX
self.Emit("MOVQ" , jit.Imm(_BM_space), _DX) // MOVQ _BM_space, DX
self.Emit("CMPQ" , _AX, jit.Imm(' ')) // CMPQ AX, $' '
self.Sjmp("JA" , "_decode_fast") // JA _decode_fast
self.Emit("BTQ" , _AX, _DX) // BTQ _AX, _DX
self.Sjmp("JNC" , "_decode_fast") // JNC _decode_fast
self.Emit("ADDQ" , jit.Imm(1), _IC) // ADDQ $1, IC
/* at least 1 to 3 spaces */
for i := 0; i < 3; i++ {
self.Emit("CMPQ" , _IC, _IL) // CMPQ IC, IL
self.Sjmp("JAE" , "_decode_V_EOF") // JAE _decode_V_EOF
self.Emit("MOVBQZX", jit.Sib(_IP, _IC, 1, 0), _AX) // MOVBQZX (IP)(IC), AX
self.Emit("CMPQ" , _AX, jit.Imm(' ')) // CMPQ AX, $' '
self.Sjmp("JA" , "_decode_fast") // JA _decode_fast
self.Emit("BTQ" , _AX, _DX) // BTQ _AX, _DX
self.Sjmp("JNC" , "_decode_fast") // JNC _decode_fast
self.Emit("ADDQ" , jit.Imm(1), _IC) // ADDQ $1, IC
}
/* at least 4 spaces */
self.Emit("CMPQ" , _IC, _IL) // CMPQ IC, IL
self.Sjmp("JAE" , "_decode_V_EOF") // JAE _decode_V_EOF
self.Emit("MOVBQZX", jit.Sib(_IP, _IC, 1, 0), _AX) // MOVBQZX (IP)(IC), AX
/* fast path: use lookup table to select decoder */
self.Link("_decode_fast") // _decode_fast:
self.Byte(0x48, 0x8d, 0x3d) // LEAQ ?(PC), DI
self.Sref("_decode_tab", 4) // .... &_decode_tab
self.Emit("MOVLQSX", jit.Sib(_DI, _AX, 4, 0), _AX) // MOVLQSX (DI)(AX*4), AX
self.Emit("TESTQ" , _AX, _AX) // TESTQ AX, AX
self.Sjmp("JZ" , "_decode_native") // JZ _decode_native
self.Emit("ADDQ" , jit.Imm(1), _IC) // ADDQ $1, IC
self.Emit("ADDQ" , _DI, _AX) // ADDQ DI, AX
self.Rjmp("JMP" , _AX) // JMP AX
/* decode with native decoder */
self.Link("_decode_native") // _decode_native:
self.Emit("MOVQ", _IP, _DI) // MOVQ IP, DI
self.Emit("MOVQ", _IL, _SI) // MOVQ IL, SI
self.Emit("MOVQ", _IC, _DX) // MOVQ IC, DX
self.Emit("LEAQ", _VAR_ss, _CX) // LEAQ ss, CX
self.Emit("MOVQ", _VAR_df, _R8) // MOVQ $df, R8
self.Emit("BTSQ", jit.Imm(_F_allow_control), _R8) // ANDQ $1<<_F_allow_control, R8
self.call(_F_value) // CALL value
self.Emit("MOVQ", _AX, _IC) // MOVQ AX, IC
/* check for errors */
self.Emit("MOVQ" , _VAR_ss_Vt, _AX) // MOVQ ss.Vt, AX
self.Emit("TESTQ", _AX, _AX) // TESTQ AX, AX
self.Sjmp("JS" , "_parsing_error")
self.Sjmp("JZ" , "_invalid_vtype") // JZ _invalid_vtype
self.Emit("CMPQ" , _AX, _V_max) // CMPQ AX, _V_max
self.Sjmp("JA" , "_invalid_vtype") // JA _invalid_vtype
/* jump table selector */
self.Byte(0x48, 0x8d, 0x3d) // LEAQ ?(PC), DI
self.Sref("_switch_table", 4) // .... &_switch_table
self.Emit("MOVLQSX", jit.Sib(_DI, _AX, 4, -4), _AX) // MOVLQSX -4(DI)(AX*4), AX
self.Emit("ADDQ" , _DI, _AX) // ADDQ DI, AX
self.Rjmp("JMP" , _AX) // JMP AX
/** V_EOF **/
self.Link("_decode_V_EOF") // _decode_V_EOF:
self.Emit("MOVL", _E_eof, _EP) // MOVL _E_eof, EP
self.Sjmp("JMP" , "_error") // JMP _error
/** V_NULL **/
self.Link("_decode_V_NULL") // _decode_V_NULL:
self.Emit("XORL", _R8, _R8) // XORL R8, R8
self.Emit("XORL", _R9, _R9) // XORL R9, R9
self.Emit("LEAQ", jit.Ptr(_IC, -4), _DI) // LEAQ -4(IC), DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_TRUE **/
self.Link("_decode_V_TRUE") // _decode_V_TRUE:
self.Emit("MOVQ", _T_bool, _R8) // MOVQ _T_bool, R8
// TODO: maybe modified by users?
self.Emit("MOVQ", _V_true, _R9) // MOVQ _V_true, R9
self.Emit("LEAQ", jit.Ptr(_IC, -4), _DI) // LEAQ -4(IC), DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_FALSE **/
self.Link("_decode_V_FALSE") // _decode_V_FALSE:
self.Emit("MOVQ", _T_bool, _R8) // MOVQ _T_bool, R8
self.Emit("MOVQ", _V_false, _R9) // MOVQ _V_false, R9
self.Emit("LEAQ", jit.Ptr(_IC, -5), _DI) // LEAQ -5(IC), DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_ARRAY **/
self.Link("_decode_V_ARRAY") // _decode_V_ARRAY
self.Emit("MOVL", jit.Imm(_S_vmask), _DX) // MOVL _S_vmask, DX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX) // BTQ AX, DX
self.Sjmp("JNC" , "_invalid_char") // JNC _invalid_char
/* create a new array */
self.Emit("MOVQ", _T_eface, _AX) // MOVQ _T_eface, AX
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 0)) // MOVQ AX, (SP)
self.Emit("MOVQ", jit.Imm(_A_init_len), jit.Ptr(_SP, 8)) // MOVQ _A_init_len, 8(SP)
self.Emit("MOVQ", jit.Imm(_A_init_cap), jit.Ptr(_SP, 16)) // MOVQ _A_init_cap, 16(SP)
self.call_go(_F_makeslice) // CALL_GO runtime.makeslice
self.Emit("MOVQ", jit.Ptr(_SP, 24), _DX) // MOVQ 24(SP), DX
/* pack into an interface */
self.Emit("MOVQ", _DX, jit.Ptr(_SP, 0)) // MOVQ DX, (SP)
self.Emit("MOVQ", jit.Imm(_A_init_len), jit.Ptr(_SP, 8)) // MOVQ _A_init_len, 8(SP)
self.Emit("MOVQ", jit.Imm(_A_init_cap), jit.Ptr(_SP, 16)) // MOVQ _A_init_cap, 16(SP)
self.call_go(_F_convTslice) // CALL_GO runtime.convTslice
self.Emit("MOVQ", jit.Ptr(_SP, 24), _R8) // MOVQ 24(SP), R8
/* replace current state with an array */
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Imm(_S_arr), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_arr, ST.Vt[CX]
self.Emit("MOVQ", _T_slice, _AX) // MOVQ _T_slice, AX
self.Emit("MOVQ", _AX, jit.Ptr(_SI, 0)) // MOVQ AX, (SI)
self.WriteRecNotAX(2, _R8, jit.Ptr(_SI, 8), false) // MOVQ R8, 8(SI)
/* add a new slot for the first element */
self.Emit("ADDQ", jit.Imm(1), _CX) // ADDQ $1, CX
self.Emit("CMPQ", _CX, jit.Imm(types.MAX_RECURSE)) // CMPQ CX, ${types.MAX_RECURSE}
self.Sjmp("JAE" , "_stack_overflow") // JA _stack_overflow
self.Emit("MOVQ", jit.Ptr(_R8, 0), _AX) // MOVQ (R8), AX
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.WritePtrAX(3, jit.Sib(_ST, _CX, 8, _ST_Vp), false) // MOVQ AX, ST.Vp[CX]
self.Emit("MOVQ", jit.Imm(_S_arr_0), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_arr_0, ST.Vt[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/** V_OBJECT **/
self.Link("_decode_V_OBJECT") // _decode_V_OBJECT:
self.Emit("MOVL", jit.Imm(_S_vmask), _DX) // MOVL _S_vmask, DX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX) // BTQ AX, DX
self.Sjmp("JNC" , "_invalid_char") // JNC _invalid_char
self.call_go(_F_makemap_small) // CALL_GO runtime.makemap_small
self.Emit("MOVQ", jit.Ptr(_SP, 0), _AX) // MOVQ (SP), AX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Imm(_S_obj_0), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_obj, ST.Vt[CX]
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", _T_map, _DX) // MOVQ _T_map, DX
self.Emit("MOVQ", _DX, jit.Ptr(_SI, 0)) // MOVQ DX, (SI)
self.WritePtrAX(4, jit.Ptr(_SI, 8), false) // MOVQ AX, 8(SI)
self.Sjmp("JMP" , "_next") // JMP _next
/** V_STRING **/
self.Link("_decode_V_STRING") // _decode_V_STRING:
self.Emit("MOVQ", _VAR_ss_Iv, _CX) // MOVQ ss.Iv, CX
self.Emit("MOVQ", _IC, _AX) // MOVQ IC, AX
self.Emit("SUBQ", _CX, _AX) // SUBQ CX, AX
/* check for escapes */
self.Emit("CMPQ", _VAR_ss_Ep, jit.Imm(-1)) // CMPQ ss.Ep, $-1
self.Sjmp("JNE" , "_unquote") // JNE _unquote
self.Emit("SUBQ", jit.Imm(1), _AX) // SUBQ $1, AX
self.Emit("LEAQ", jit.Sib(_IP, _CX, 1, 0), _R8) // LEAQ (IP)(CX), R8
self.Byte(0x48, 0x8d, 0x3d) // LEAQ (PC), DI
self.Sref("_copy_string_end", 4)
self.Emit("BTQ", jit.Imm(_F_copy_string), _VAR_df)
self.Sjmp("JC", "copy_string")
self.Link("_copy_string_end")
self.Emit("XORL", _DX, _DX) // XORL DX, DX
/* strings with no escape sequences */
self.Link("_noescape") // _noescape:
self.Emit("MOVL", jit.Imm(_S_omask_key), _DI) // MOVL _S_omask, DI
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _SI) // MOVQ ST.Vt[CX], SI
self.Emit("BTQ" , _SI, _DI) // BTQ SI, DI
self.Sjmp("JC" , "_object_key") // JC _object_key
/* check for pre-packed strings, avoid 1 allocation */
self.Emit("TESTQ", _DX, _DX) // TESTQ DX, DX
self.Sjmp("JNZ" , "_packed_str") // JNZ _packed_str
self.Emit("MOVQ" , _R8, jit.Ptr(_SP, 0)) // MOVQ R8, (SP)
self.Emit("MOVQ" , _AX, jit.Ptr(_SP, 8)) // MOVQ AX, 8(SP)
self.call_go(_F_convTstring) // CALL_GO runtime.convTstring
self.Emit("MOVQ" , jit.Ptr(_SP, 16), _R9) // MOVQ 16(SP), R9
/* packed string already in R9 */
self.Link("_packed_str") // _packed_str:
self.Emit("MOVQ", _T_string, _R8) // MOVQ _T_string, R8
self.Emit("MOVQ", _VAR_ss_Iv, _DI) // MOVQ ss.Iv, DI
self.Emit("SUBQ", jit.Imm(1), _DI) // SUBQ $1, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/* the string is an object key, get the map */
self.Link("_object_key")
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
/* add a new delimiter */
self.Emit("ADDQ", jit.Imm(1), _CX) // ADDQ $1, CX
self.Emit("CMPQ", _CX, jit.Imm(types.MAX_RECURSE)) // CMPQ CX, ${types.MAX_RECURSE}
self.Sjmp("JAE" , "_stack_overflow") // JA _stack_overflow
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.Emit("MOVQ", jit.Imm(_S_obj_delim), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_obj_delim, ST.Vt[CX]
/* add a new slot int the map */
self.Emit("MOVQ", _T_map, _DX) // MOVQ _T_map, DX
self.Emit("MOVQ", _DX, jit.Ptr(_SP, 0)) // MOVQ DX, (SP)
self.Emit("MOVQ", _SI, jit.Ptr(_SP, 8)) // MOVQ SI, 8(SP)
self.Emit("MOVQ", _R8, jit.Ptr(_SP, 16)) // MOVQ R9, 16(SP)
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 24)) // MOVQ AX, 24(SP)
self.call_go(_F_mapassign_faststr) // CALL_GO runtime.mapassign_faststr
self.Emit("MOVQ", jit.Ptr(_SP, 32), _AX) // MOVQ 32(SP), AX
/* add to the pointer stack */
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.WritePtrAX(6, jit.Sib(_ST, _CX, 8, _ST_Vp), false) // MOVQ AX, ST.Vp[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/* allocate memory to store the string header and unquoted result */
self.Link("_unquote") // _unquote:
self.Emit("ADDQ", jit.Imm(15), _AX) // ADDQ $15, AX
self.Emit("MOVQ", _T_byte, _CX) // MOVQ _T_byte, CX
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 0)) // MOVQ AX, (SP)
self.Emit("MOVQ", _CX, jit.Ptr(_SP, 8)) // MOVQ CX, 8(SP)
self.Emit("MOVB", jit.Imm(0), jit.Ptr(_SP, 16)) // MOVB $0, 16(SP)
self.call_go(_F_mallocgc) // CALL_GO runtime.mallocgc
self.Emit("MOVQ", jit.Ptr(_SP, 24), _R9) // MOVQ 24(SP), R9
/* prepare the unquoting parameters */
self.Emit("MOVQ" , _VAR_ss_Iv, _CX) // MOVQ ss.Iv, CX
self.Emit("LEAQ" , jit.Sib(_IP, _CX, 1, 0), _DI) // LEAQ (IP)(CX), DI
self.Emit("NEGQ" , _CX) // NEGQ CX
self.Emit("LEAQ" , jit.Sib(_IC, _CX, 1, -1), _SI) // LEAQ -1(IC)(CX), SI
self.Emit("LEAQ" , jit.Ptr(_R9, 16), _DX) // LEAQ 16(R8), DX
self.Emit("LEAQ" , _VAR_ss_Ep, _CX) // LEAQ ss.Ep, CX
self.Emit("XORL" , _R8, _R8) // XORL R8, R8
self.Emit("BTQ" , jit.Imm(_F_disable_urc), _VAR_df) // BTQ ${_F_disable_urc}, fv
self.Emit("SETCC", _R8) // SETCC R8
self.Emit("SHLQ" , jit.Imm(types.B_UNICODE_REPLACE), _R8) // SHLQ ${types.B_UNICODE_REPLACE}, R8
/* unquote the string, with R9 been preserved */
self.save(_R9) // SAVE R9
self.call(_F_unquote) // CALL unquote
self.load(_R9) // LOAD R9
/* check for errors */
self.Emit("TESTQ", _AX, _AX) // TESTQ AX, AX
self.Sjmp("JS" , "_unquote_error") // JS _unquote_error
self.Emit("MOVL" , jit.Imm(1), _DX) // MOVL $1, DX
self.Emit("LEAQ" , jit.Ptr(_R9, 16), _R8) // ADDQ $16, R8
self.Emit("MOVQ" , _R8, jit.Ptr(_R9, 0)) // MOVQ R8, (R9)
self.Emit("MOVQ" , _AX, jit.Ptr(_R9, 8)) // MOVQ AX, 8(R9)
self.Sjmp("JMP" , "_noescape") // JMP _noescape
/** V_DOUBLE **/
self.Link("_decode_V_DOUBLE") // _decode_V_DOUBLE:
self.Emit("BTQ" , jit.Imm(_F_use_number), _VAR_df) // BTQ _F_use_number, df
self.Sjmp("JC" , "_use_number") // JC _use_number
self.Emit("MOVSD", _VAR_ss_Dv, _X0) // MOVSD ss.Dv, X0
self.Sjmp("JMP" , "_use_float64") // JMP _use_float64
/** V_INTEGER **/
self.Link("_decode_V_INTEGER") // _decode_V_INTEGER:
self.Emit("BTQ" , jit.Imm(_F_use_number), _VAR_df) // BTQ _F_use_number, df
self.Sjmp("JC" , "_use_number") // JC _use_number
self.Emit("BTQ" , jit.Imm(_F_use_int64), _VAR_df) // BTQ _F_use_int64, df
self.Sjmp("JC" , "_use_int64") // JC _use_int64
self.Emit("MOVQ" , _VAR_ss_Iv, _AX) // MOVQ ss.Iv, AX
self.Emit("CVTSQ2SD", _AX, _X0) // CVTSQ2SD AX, X0
/* represent numbers as `float64` */
self.Link("_use_float64") // _use_float64:
self.Emit("MOVSD", _X0, jit.Ptr(_SP, 0)) // MOVSD X0, (SP)
self.call_go(_F_convT64) // CALL_GO runtime.convT64
self.Emit("MOVQ" , _T_float64, _R8) // MOVQ _T_float64, R8
self.Emit("MOVQ" , jit.Ptr(_SP, 8), _R9) // MOVQ 8(SP), R9
self.Emit("MOVQ" , _VAR_ss_Ep, _DI) // MOVQ ss.Ep, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/* represent numbers as `json.Number` */
self.Link("_use_number") // _use_number
self.Emit("MOVQ", _VAR_ss_Ep, _AX) // MOVQ ss.Ep, AX
self.Emit("LEAQ", jit.Sib(_IP, _AX, 1, 0), _SI) // LEAQ (IP)(AX), SI
self.Emit("MOVQ", _IC, _CX) // MOVQ IC, CX
self.Emit("SUBQ", _AX, _CX) // SUBQ AX, CX
self.Emit("MOVQ", _SI, jit.Ptr(_SP, 0)) // MOVQ SI, (SP)
self.Emit("MOVQ", _CX, jit.Ptr(_SP, 8)) // MOVQ CX, 8(SP)
self.call_go(_F_convTstring) // CALL_GO runtime.convTstring
self.Emit("MOVQ", _T_number, _R8) // MOVQ _T_number, R8
self.Emit("MOVQ", jit.Ptr(_SP, 16), _R9) // MOVQ 16(SP), R9
self.Emit("MOVQ", _VAR_ss_Ep, _DI) // MOVQ ss.Ep, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/* represent numbers as `int64` */
self.Link("_use_int64") // _use_int64:
self.Emit("MOVQ", _VAR_ss_Iv, _AX) // MOVQ ss.Iv, AX
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 0)) // MOVQ AX, (SP)
self.call_go(_F_convT64) // CALL_GO runtime.convT64
self.Emit("MOVQ", _T_int64, _R8) // MOVQ _T_int64, R8
self.Emit("MOVQ", jit.Ptr(_SP, 8), _R9) // MOVQ 8(SP), R9
self.Emit("MOVQ", _VAR_ss_Ep, _DI) // MOVQ ss.Ep, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_KEY_SEP **/
self.Link("_decode_V_KEY_SEP") // _decode_V_KEY_SEP:
// self.Byte(0xcc)
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("CMPQ", _AX, jit.Imm(_S_obj_delim)) // CMPQ AX, _S_obj_delim
self.Sjmp("JNE" , "_invalid_char") // JNE _invalid_char
self.Emit("MOVQ", jit.Imm(_S_val), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_val, ST.Vt[CX]
self.Emit("MOVQ", jit.Imm(_S_obj), jit.Sib(_ST, _CX, 8, _ST_Vt - 8)) // MOVQ _S_obj, ST.Vt[CX - 1]
self.Sjmp("JMP" , "_next") // JMP _next
/** V_ELEM_SEP **/
self.Link("_decode_V_ELEM_SEP") // _decode_V_ELEM_SEP:
self.Emit("MOVQ" , jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ" , jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("CMPQ" , _AX, jit.Imm(_S_arr)) // CMPQ _AX, _S_arr
self.Sjmp("JE" , "_array_sep") // JZ _next
self.Emit("CMPQ" , _AX, jit.Imm(_S_obj)) // CMPQ _AX, _S_arr
self.Sjmp("JNE" , "_invalid_char") // JNE _invalid_char
self.Emit("MOVQ" , jit.Imm(_S_obj_sep), jit.Sib(_ST, _CX, 8, _ST_Vt))
self.Sjmp("JMP" , "_next") // JMP _next
/* arrays */
self.Link("_array_sep")
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _DX) // MOVQ 8(SI), DX
self.Emit("CMPQ", _DX, jit.Ptr(_SI, 16)) // CMPQ DX, 16(SI)
self.Sjmp("JAE" , "_array_more") // JAE _array_more
/* add a slot for the new element */
self.Link("_array_append") // _array_append:
self.Emit("ADDQ", jit.Imm(1), jit.Ptr(_SI, 8)) // ADDQ $1, 8(SI)
self.Emit("MOVQ", jit.Ptr(_SI, 0), _SI) // MOVQ (SI), SI
self.Emit("ADDQ", jit.Imm(1), _CX) // ADDQ $1, CX
self.Emit("CMPQ", _CX, jit.Imm(types.MAX_RECURSE)) // CMPQ CX, ${types.MAX_RECURSE}
self.Sjmp("JAE" , "_stack_overflow")
self.Emit("SHLQ", jit.Imm(1), _DX) // SHLQ $1, DX
self.Emit("LEAQ", jit.Sib(_SI, _DX, 8, 0), _SI) // LEAQ (SI)(DX*8), SI
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.WriteRecNotAX(7 , _SI, jit.Sib(_ST, _CX, 8, _ST_Vp), false) // MOVQ SI, ST.Vp[CX]
self.Emit("MOVQ", jit.Imm(_S_val), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_val, ST.Vt[CX}
self.Sjmp("JMP" , "_next") // JMP _next
/** V_ARRAY_END **/
self.Link("_decode_V_ARRAY_END") // _decode_V_ARRAY_END:
self.Emit("XORL", _DX, _DX) // XORL DX, DX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("CMPQ", _AX, jit.Imm(_S_arr_0)) // CMPQ AX, _S_arr_0
self.Sjmp("JE" , "_first_item") // JE _first_item
self.Emit("CMPQ", _AX, jit.Imm(_S_arr)) // CMPQ AX, _S_arr
self.Sjmp("JNE" , "_invalid_char") // JNE _invalid_char
self.Emit("SUBQ", jit.Imm(1), jit.Ptr(_ST, _ST_Sp)) // SUBQ $1, ST.Sp
self.Emit("MOVQ", _DX, jit.Sib(_ST, _CX, 8, _ST_Vp)) // MOVQ DX, ST.Vp[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/* first element of an array */
self.Link("_first_item") // _first_item:
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("SUBQ", jit.Imm(2), jit.Ptr(_ST, _ST_Sp)) // SUBQ $2, ST.Sp
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp - 8), _SI) // MOVQ ST.Vp[CX - 1], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
self.Emit("MOVQ", _DX, jit.Sib(_ST, _CX, 8, _ST_Vp - 8)) // MOVQ DX, ST.Vp[CX - 1]
self.Emit("MOVQ", _DX, jit.Sib(_ST, _CX, 8, _ST_Vp)) // MOVQ DX, ST.Vp[CX]
self.Emit("MOVQ", _DX, jit.Ptr(_SI, 8)) // MOVQ DX, 8(SI)
self.Sjmp("JMP" , "_next") // JMP _next
/** V_OBJECT_END **/
self.Link("_decode_V_OBJECT_END") // _decode_V_OBJECT_END:
self.Emit("MOVL", jit.Imm(_S_omask_end), _DX) // MOVL _S_omask, DI
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX)
self.Sjmp("JNC" , "_invalid_char") // JNE _invalid_char
self.Emit("XORL", _AX, _AX) // XORL AX, AX
self.Emit("SUBQ", jit.Imm(1), jit.Ptr(_ST, _ST_Sp)) // SUBQ $1, ST.Sp
self.Emit("MOVQ", _AX, jit.Sib(_ST, _CX, 8, _ST_Vp)) // MOVQ AX, ST.Vp[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/* return from decoder */
self.Link("_return") // _return:
self.Emit("XORL", _EP, _EP) // XORL EP, EP
self.Emit("MOVQ", _EP, jit.Ptr(_ST, _ST_Vp)) // MOVQ EP, ST.Vp[0]
self.Link("_epilogue") // _epilogue:
self.Emit("SUBQ", jit.Imm(_FsmOffset), _ST) // SUBQ _FsmOffset, _ST
self.Emit("MOVQ", jit.Ptr(_SP, _VD_offs), _BP) // MOVQ _VD_offs(SP), BP
self.Emit("ADDQ", jit.Imm(_VD_size), _SP) // ADDQ $_VD_size, SP
self.Emit("RET") // RET
/* array expand */
self.Link("_array_more") // _array_more:
self.Emit("MOVQ" , _T_eface, _AX) // MOVQ _T_eface, AX
self.Emit("MOVOU", jit.Ptr(_SI, 0), _X0) // MOVOU (SI), X0
self.Emit("MOVQ" , jit.Ptr(_SI, 16), _DX) // MOVQ 16(SI), DX
self.Emit("MOVQ" , _AX, jit.Ptr(_SP, 0)) // MOVQ AX, (SP)
self.Emit("MOVOU", _X0, jit.Ptr(_SP, 8)) // MOVOU X0, 8(SP)
self.Emit("MOVQ" , _DX, jit.Ptr(_SP, 24)) // MOVQ DX, 24(SP)
self.Emit("SHLQ" , jit.Imm(1), _DX) // SHLQ $1, DX
self.Emit("MOVQ" , _DX, jit.Ptr(_SP, 32)) // MOVQ DX, 32(SP)
self.call_go(_F_growslice) // CALL_GO runtime.growslice
self.Emit("MOVQ" , jit.Ptr(_SP, 40), _DI) // MOVOU 40(SP), DI
self.Emit("MOVQ" , jit.Ptr(_SP, 48), _DX) // MOVOU 48(SP), DX
self.Emit("MOVQ" , jit.Ptr(_SP, 56), _AX) // MOVQ 56(SP), AX
/* update the slice */
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
self.Emit("MOVQ", _DX, jit.Ptr(_SI, 8)) // MOVQ DX, 8(SI)
self.Emit("MOVQ", _AX, jit.Ptr(_SI, 16)) // MOVQ AX, 16(AX)
self.WriteRecNotAX(8 , _DI, jit.Ptr(_SI, 0), false) // MOVQ R10, (SI)
self.Sjmp("JMP" , "_array_append") // JMP _array_append
/* copy string */
self.Link("copy_string") // pointer: R8, length: AX, return addr: DI
// self.Byte(0xcc)
self.Emit("MOVQ", _R8, _VAR_cs_p)
self.Emit("MOVQ", _AX, _VAR_cs_n)
self.Emit("MOVQ", _DI, _VAR_cs_LR)
self.Emit("MOVQ", _T_byte, jit.Ptr(_SP, 0))
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 8))
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 16))
self.call_go(_F_makeslice)
self.Emit("MOVQ", jit.Ptr(_SP, 24), _R8)
self.Emit("MOVQ", _R8, _VAR_cs_d)
self.Emit("MOVQ", _R8, jit.Ptr(_SP, 0))
self.Emit("MOVQ", _VAR_cs_p, _R8)
self.Emit("MOVQ", _R8, jit.Ptr(_SP, 8))
self.Emit("MOVQ", _VAR_cs_n, _AX)
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 16))
self.call_go(_F_memmove)
self.Emit("MOVQ", _VAR_cs_d, _R8)
self.Emit("MOVQ", _VAR_cs_n, _AX)
self.Emit("MOVQ", _VAR_cs_LR, _DI)
// self.Byte(0xcc)
self.Rjmp("JMP", _DI)
/* error handlers */
self.Link("_stack_overflow")
self.Emit("MOVL" , _E_recurse, _EP) // MOVQ _E_recurse, EP
self.Sjmp("JMP" , "_error") // JMP _error
self.Link("_vtype_error") // _vtype_error:
self.Emit("MOVQ" , _DI, _IC) // MOVQ DI, IC
self.Emit("MOVL" , _E_invalid, _EP) // MOVL _E_invalid, EP
self.Sjmp("JMP" , "_error") // JMP _error
self.Link("_invalid_char") // _invalid_char:
self.Emit("SUBQ" , jit.Imm(1), _IC) // SUBQ $1, IC
self.Emit("MOVL" , _E_invalid, _EP) // MOVL _E_invalid, EP
self.Sjmp("JMP" , "_error") // JMP _error
self.Link("_unquote_error") // _unquote_error:
self.Emit("MOVQ" , _VAR_ss_Iv, _IC) // MOVQ ss.Iv, IC
self.Emit("SUBQ" , jit.Imm(1), _IC) // SUBQ $1, IC
self.Link("_parsing_error") // _parsing_error:
self.Emit("NEGQ" , _AX) // NEGQ AX
self.Emit("MOVQ" , _AX, _EP) // MOVQ AX, EP
self.Link("_error") // _error:
self.Emit("PXOR" , _X0, _X0) // PXOR X0, X0
self.Emit("MOVOU", _X0, jit.Ptr(_VP, 0)) // MOVOU X0, (VP)
self.Sjmp("JMP" , "_epilogue") // JMP _epilogue
/* invalid value type, never returns */
self.Link("_invalid_vtype")
self.Emit("MOVQ", _AX, jit.Ptr(_SP, 0)) // MOVQ AX, (SP)
self.call(_F_invalid_vtype) // CALL invalid_type
self.Emit("UD2") // UD2
/* switch jump table */
self.Link("_switch_table") // _switch_table:
self.Sref("_decode_V_EOF", 0) // SREF &_decode_V_EOF, $0
self.Sref("_decode_V_NULL", -4) // SREF &_decode_V_NULL, $-4
self.Sref("_decode_V_TRUE", -8) // SREF &_decode_V_TRUE, $-8
self.Sref("_decode_V_FALSE", -12) // SREF &_decode_V_FALSE, $-12
self.Sref("_decode_V_ARRAY", -16) // SREF &_decode_V_ARRAY, $-16
self.Sref("_decode_V_OBJECT", -20) // SREF &_decode_V_OBJECT, $-20
self.Sref("_decode_V_STRING", -24) // SREF &_decode_V_STRING, $-24
self.Sref("_decode_V_DOUBLE", -28) // SREF &_decode_V_DOUBLE, $-28
self.Sref("_decode_V_INTEGER", -32) // SREF &_decode_V_INTEGER, $-32
self.Sref("_decode_V_KEY_SEP", -36) // SREF &_decode_V_KEY_SEP, $-36
self.Sref("_decode_V_ELEM_SEP", -40) // SREF &_decode_V_ELEM_SEP, $-40
self.Sref("_decode_V_ARRAY_END", -44) // SREF &_decode_V_ARRAY_END, $-44
self.Sref("_decode_V_OBJECT_END", -48) // SREF &_decode_V_OBJECT_END, $-48
/* fast character lookup table */
self.Link("_decode_tab") // _decode_tab:
self.Sref("_decode_V_EOF", 0) // SREF &_decode_V_EOF, $0
/* generate rest of the tabs */
for i := 1; i < 256; i++ {
if to, ok := _R_tab[i]; ok {
self.Sref(to, -int64(i) * 4)
} else {
self.Byte(0x00, 0x00, 0x00, 0x00)
}
}
}
func (self *_ValueDecoder) WritePtrAX(i int, rec obj.Addr, saveDI bool) {
self.Emit("MOVQ", _V_writeBarrier, _R10)
self.Emit("CMPL", jit.Ptr(_R10, 0), jit.Imm(0))
self.Sjmp("JE", "_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
if saveDI {
self.save(_DI)
}
self.Emit("LEAQ", rec, _DI)
self.Emit("MOVQ", _F_gcWriteBarrierAX, _R10) // MOVQ ${fn}, AX
self.Rjmp("CALL", _R10)
if saveDI {
self.load(_DI)
}
self.Sjmp("JMP", "_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Link("_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Emit("MOVQ", _AX, rec)
self.Link("_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
}
func (self *_ValueDecoder) WriteRecNotAX(i int, ptr obj.Addr, rec obj.Addr, saveDI bool) {
if rec.Reg == x86.REG_AX || rec.Index == x86.REG_AX {
panic("rec contains AX!")
}
self.Emit("MOVQ", _V_writeBarrier, _R10)
self.Emit("CMPL", jit.Ptr(_R10, 0), jit.Imm(0))
self.Sjmp("JE", "_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Emit("MOVQ", ptr, _AX)
if saveDI {
self.save(_DI)
}
self.Emit("LEAQ", rec, _DI)
self.Emit("MOVQ", _F_gcWriteBarrierAX, _R10) // MOVQ ${fn}, AX
self.Rjmp("CALL", _R10)
if saveDI {
self.load(_DI)
}
self.Sjmp("JMP", "_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Link("_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Emit("MOVQ", ptr, rec)
self.Link("_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
}
/** Generic Decoder **/
var (
_subr_decode_value = new(_ValueDecoder).build()
)
//go:nosplit
func invalid_vtype(vt types.ValueType) {
throw(fmt.Sprintf("invalid value type: %d", vt))
}

View File

@@ -1,772 +0,0 @@
//go:build go1.17 && !go1.21
// +build go1.17,!go1.21
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package decoder
import (
`encoding/json`
`fmt`
`reflect`
`strconv`
`github.com/bytedance/sonic/internal/jit`
`github.com/bytedance/sonic/internal/native`
`github.com/bytedance/sonic/internal/native/types`
`github.com/twitchyliquid64/golang-asm/obj`
`github.com/twitchyliquid64/golang-asm/obj/x86`
)
/** Crucial Registers:
*
* ST(R13) && 0(SP) : ro, decoder stack
* DF(AX) : ro, decoder flags
* EP(BX) : wo, error pointer
* IP(R10) : ro, input pointer
* IL(R12) : ro, input length
* IC(R11) : rw, input cursor
* VP(R15) : ro, value pointer (to an interface{})
*/
const (
_VD_args = 8 // 8 bytes for passing arguments to this functions
_VD_fargs = 64 // 64 bytes for passing arguments to other Go functions
_VD_saves = 48 // 48 bytes for saving the registers before CALL instructions
_VD_locals = 96 // 96 bytes for local variables
)
const (
_VD_offs = _VD_fargs + _VD_saves + _VD_locals
_VD_size = _VD_offs + 8 // 8 bytes for the parent frame pointer
)
var (
_VAR_ss = _VAR_ss_Vt
_VAR_df = jit.Ptr(_SP, _VD_fargs + _VD_saves)
)
var (
_VAR_ss_Vt = jit.Ptr(_SP, _VD_fargs + _VD_saves + 8)
_VAR_ss_Dv = jit.Ptr(_SP, _VD_fargs + _VD_saves + 16)
_VAR_ss_Iv = jit.Ptr(_SP, _VD_fargs + _VD_saves + 24)
_VAR_ss_Ep = jit.Ptr(_SP, _VD_fargs + _VD_saves + 32)
_VAR_ss_Db = jit.Ptr(_SP, _VD_fargs + _VD_saves + 40)
_VAR_ss_Dc = jit.Ptr(_SP, _VD_fargs + _VD_saves + 48)
)
var (
_VAR_R9 = jit.Ptr(_SP, _VD_fargs + _VD_saves + 56)
)
type _ValueDecoder struct {
jit.BaseAssembler
}
var (
_VAR_cs_LR = jit.Ptr(_SP, _VD_fargs + _VD_saves + 64)
_VAR_cs_p = jit.Ptr(_SP, _VD_fargs + _VD_saves + 72)
_VAR_cs_n = jit.Ptr(_SP, _VD_fargs + _VD_saves + 80)
_VAR_cs_d = jit.Ptr(_SP, _VD_fargs + _VD_saves + 88)
)
func (self *_ValueDecoder) build() uintptr {
self.Init(self.compile)
return *(*uintptr)(self.Load("decode_value", _VD_size, _VD_args, argPtrs_generic, localPtrs_generic))
}
/** Function Calling Helpers **/
func (self *_ValueDecoder) save(r ...obj.Addr) {
for i, v := range r {
if i > _VD_saves / 8 - 1 {
panic("too many registers to save")
} else {
self.Emit("MOVQ", v, jit.Ptr(_SP, _VD_fargs + int64(i) * 8))
}
}
}
func (self *_ValueDecoder) load(r ...obj.Addr) {
for i, v := range r {
if i > _VD_saves / 8 - 1 {
panic("too many registers to load")
} else {
self.Emit("MOVQ", jit.Ptr(_SP, _VD_fargs + int64(i) * 8), v)
}
}
}
func (self *_ValueDecoder) call(fn obj.Addr) {
self.Emit("MOVQ", fn, _R9) // MOVQ ${fn}, AX
self.Rjmp("CALL", _R9) // CALL AX
}
func (self *_ValueDecoder) call_go(fn obj.Addr) {
self.save(_REG_go...) // SAVE $REG_go
self.call(fn) // CALL ${fn}
self.load(_REG_go...) // LOAD $REG_go
}
func (self *_ValueDecoder) callc(fn obj.Addr) {
self.Emit("XCHGQ", _IP, _BP)
self.call(fn)
self.Emit("XCHGQ", _IP, _BP)
}
func (self *_ValueDecoder) call_c(fn obj.Addr) {
self.Emit("XCHGQ", _IC, _BX)
self.callc(fn)
self.Emit("XCHGQ", _IC, _BX)
}
/** Decoder Assembler **/
const (
_S_val = iota + 1
_S_arr
_S_arr_0
_S_obj
_S_obj_0
_S_obj_delim
_S_obj_sep
)
const (
_S_omask_key = (1 << _S_obj_0) | (1 << _S_obj_sep)
_S_omask_end = (1 << _S_obj_0) | (1 << _S_obj)
_S_vmask = (1 << _S_val) | (1 << _S_arr_0)
)
const (
_A_init_len = 1
_A_init_cap = 16
)
const (
_ST_Sp = 0
_ST_Vt = _PtrBytes
_ST_Vp = _PtrBytes * (types.MAX_RECURSE + 1)
)
var (
_V_true = jit.Imm(int64(pbool(true)))
_V_false = jit.Imm(int64(pbool(false)))
_F_value = jit.Imm(int64(native.S_value))
)
var (
_V_max = jit.Imm(int64(types.V_MAX))
_E_eof = jit.Imm(int64(types.ERR_EOF))
_E_invalid = jit.Imm(int64(types.ERR_INVALID_CHAR))
_E_recurse = jit.Imm(int64(types.ERR_RECURSE_EXCEED_MAX))
)
var (
_F_convTslice = jit.Func(convTslice)
_F_convTstring = jit.Func(convTstring)
_F_invalid_vtype = jit.Func(invalid_vtype)
)
var (
_T_map = jit.Type(reflect.TypeOf((map[string]interface{})(nil)))
_T_bool = jit.Type(reflect.TypeOf(false))
_T_int64 = jit.Type(reflect.TypeOf(int64(0)))
_T_eface = jit.Type(reflect.TypeOf((*interface{})(nil)).Elem())
_T_slice = jit.Type(reflect.TypeOf(([]interface{})(nil)))
_T_string = jit.Type(reflect.TypeOf(""))
_T_number = jit.Type(reflect.TypeOf(json.Number("")))
_T_float64 = jit.Type(reflect.TypeOf(float64(0)))
)
var _R_tab = map[int]string {
'[': "_decode_V_ARRAY",
'{': "_decode_V_OBJECT",
':': "_decode_V_KEY_SEP",
',': "_decode_V_ELEM_SEP",
']': "_decode_V_ARRAY_END",
'}': "_decode_V_OBJECT_END",
}
func (self *_ValueDecoder) compile() {
self.Emit("SUBQ", jit.Imm(_VD_size), _SP) // SUBQ $_VD_size, SP
self.Emit("MOVQ", _BP, jit.Ptr(_SP, _VD_offs)) // MOVQ BP, _VD_offs(SP)
self.Emit("LEAQ", jit.Ptr(_SP, _VD_offs), _BP) // LEAQ _VD_offs(SP), BP
/* initialize the state machine */
self.Emit("XORL", _CX, _CX) // XORL CX, CX
self.Emit("MOVQ", _DF, _VAR_df) // MOVQ DF, df
/* initialize digital buffer first */
self.Emit("MOVQ", jit.Imm(_MaxDigitNums), _VAR_ss_Dc) // MOVQ $_MaxDigitNums, ss.Dcap
self.Emit("LEAQ", jit.Ptr(_ST, _DbufOffset), _AX) // LEAQ _DbufOffset(ST), AX
self.Emit("MOVQ", _AX, _VAR_ss_Db) // MOVQ AX, ss.Dbuf
/* add ST offset */
self.Emit("ADDQ", jit.Imm(_FsmOffset), _ST) // ADDQ _FsmOffset, _ST
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.WriteRecNotAX(0, _VP, jit.Ptr(_ST, _ST_Vp), false) // MOVQ VP, ST.Vp[0]
self.Emit("MOVQ", jit.Imm(_S_val), jit.Ptr(_ST, _ST_Vt)) // MOVQ _S_val, ST.Vt[0]
self.Sjmp("JMP" , "_next") // JMP _next
/* set the value from previous round */
self.Link("_set_value") // _set_value:
self.Emit("MOVL" , jit.Imm(_S_vmask), _DX) // MOVL _S_vmask, DX
self.Emit("MOVQ" , jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ" , jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX) // BTQ AX, DX
self.Sjmp("JNC" , "_vtype_error") // JNC _vtype_error
self.Emit("XORL" , _SI, _SI) // XORL SI, SI
self.Emit("SUBQ" , jit.Imm(1), jit.Ptr(_ST, _ST_Sp)) // SUBQ $1, ST.Sp
self.Emit("XCHGQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // XCHGQ ST.Vp[CX], SI
self.Emit("MOVQ" , _R8, jit.Ptr(_SI, 0)) // MOVQ R8, (SI)
self.WriteRecNotAX(1, _R9, jit.Ptr(_SI, 8), false) // MOVQ R9, 8(SI)
/* check for value stack */
self.Link("_next") // _next:
self.Emit("MOVQ" , jit.Ptr(_ST, _ST_Sp), _AX) // MOVQ ST.Sp, AX
self.Emit("TESTQ", _AX, _AX) // TESTQ AX, AX
self.Sjmp("JS" , "_return") // JS _return
/* fast path: test up to 4 characters manually */
self.Emit("CMPQ" , _IC, _IL) // CMPQ IC, IL
self.Sjmp("JAE" , "_decode_V_EOF") // JAE _decode_V_EOF
self.Emit("MOVBQZX", jit.Sib(_IP, _IC, 1, 0), _AX) // MOVBQZX (IP)(IC), AX
self.Emit("MOVQ" , jit.Imm(_BM_space), _DX) // MOVQ _BM_space, DX
self.Emit("CMPQ" , _AX, jit.Imm(' ')) // CMPQ AX, $' '
self.Sjmp("JA" , "_decode_fast") // JA _decode_fast
self.Emit("BTQ" , _AX, _DX) // BTQ _AX, _DX
self.Sjmp("JNC" , "_decode_fast") // JNC _decode_fast
self.Emit("ADDQ" , jit.Imm(1), _IC) // ADDQ $1, IC
/* at least 1 to 3 spaces */
for i := 0; i < 3; i++ {
self.Emit("CMPQ" , _IC, _IL) // CMPQ IC, IL
self.Sjmp("JAE" , "_decode_V_EOF") // JAE _decode_V_EOF
self.Emit("MOVBQZX", jit.Sib(_IP, _IC, 1, 0), _AX) // MOVBQZX (IP)(IC), AX
self.Emit("CMPQ" , _AX, jit.Imm(' ')) // CMPQ AX, $' '
self.Sjmp("JA" , "_decode_fast") // JA _decode_fast
self.Emit("BTQ" , _AX, _DX) // BTQ _AX, _DX
self.Sjmp("JNC" , "_decode_fast") // JNC _decode_fast
self.Emit("ADDQ" , jit.Imm(1), _IC) // ADDQ $1, IC
}
/* at least 4 spaces */
self.Emit("CMPQ" , _IC, _IL) // CMPQ IC, IL
self.Sjmp("JAE" , "_decode_V_EOF") // JAE _decode_V_EOF
self.Emit("MOVBQZX", jit.Sib(_IP, _IC, 1, 0), _AX) // MOVBQZX (IP)(IC), AX
/* fast path: use lookup table to select decoder */
self.Link("_decode_fast") // _decode_fast:
self.Byte(0x48, 0x8d, 0x3d) // LEAQ ?(PC), DI
self.Sref("_decode_tab", 4) // .... &_decode_tab
self.Emit("MOVLQSX", jit.Sib(_DI, _AX, 4, 0), _AX) // MOVLQSX (DI)(AX*4), AX
self.Emit("TESTQ" , _AX, _AX) // TESTQ AX, AX
self.Sjmp("JZ" , "_decode_native") // JZ _decode_native
self.Emit("ADDQ" , jit.Imm(1), _IC) // ADDQ $1, IC
self.Emit("ADDQ" , _DI, _AX) // ADDQ DI, AX
self.Rjmp("JMP" , _AX) // JMP AX
/* decode with native decoder */
self.Link("_decode_native") // _decode_native:
self.Emit("MOVQ", _IP, _DI) // MOVQ IP, DI
self.Emit("MOVQ", _IL, _SI) // MOVQ IL, SI
self.Emit("MOVQ", _IC, _DX) // MOVQ IC, DX
self.Emit("LEAQ", _VAR_ss, _CX) // LEAQ ss, CX
self.Emit("MOVQ", _VAR_df, _R8) // MOVQ $df, R8
self.Emit("BTSQ", jit.Imm(_F_allow_control), _R8) // ANDQ $1<<_F_allow_control, R8
self.callc(_F_value) // CALL value
self.Emit("MOVQ", _AX, _IC) // MOVQ AX, IC
/* check for errors */
self.Emit("MOVQ" , _VAR_ss_Vt, _AX) // MOVQ ss.Vt, AX
self.Emit("TESTQ", _AX, _AX) // TESTQ AX, AX
self.Sjmp("JS" , "_parsing_error")
self.Sjmp("JZ" , "_invalid_vtype") // JZ _invalid_vtype
self.Emit("CMPQ" , _AX, _V_max) // CMPQ AX, _V_max
self.Sjmp("JA" , "_invalid_vtype") // JA _invalid_vtype
/* jump table selector */
self.Byte(0x48, 0x8d, 0x3d) // LEAQ ?(PC), DI
self.Sref("_switch_table", 4) // .... &_switch_table
self.Emit("MOVLQSX", jit.Sib(_DI, _AX, 4, -4), _AX) // MOVLQSX -4(DI)(AX*4), AX
self.Emit("ADDQ" , _DI, _AX) // ADDQ DI, AX
self.Rjmp("JMP" , _AX) // JMP AX
/** V_EOF **/
self.Link("_decode_V_EOF") // _decode_V_EOF:
self.Emit("MOVL", _E_eof, _EP) // MOVL _E_eof, EP
self.Sjmp("JMP" , "_error") // JMP _error
/** V_NULL **/
self.Link("_decode_V_NULL") // _decode_V_NULL:
self.Emit("XORL", _R8, _R8) // XORL R8, R8
self.Emit("XORL", _R9, _R9) // XORL R9, R9
self.Emit("LEAQ", jit.Ptr(_IC, -4), _DI) // LEAQ -4(IC), DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_TRUE **/
self.Link("_decode_V_TRUE") // _decode_V_TRUE:
self.Emit("MOVQ", _T_bool, _R8) // MOVQ _T_bool, R8
// TODO: maybe modified by users?
self.Emit("MOVQ", _V_true, _R9) // MOVQ _V_true, R9
self.Emit("LEAQ", jit.Ptr(_IC, -4), _DI) // LEAQ -4(IC), DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_FALSE **/
self.Link("_decode_V_FALSE") // _decode_V_FALSE:
self.Emit("MOVQ", _T_bool, _R8) // MOVQ _T_bool, R8
self.Emit("MOVQ", _V_false, _R9) // MOVQ _V_false, R9
self.Emit("LEAQ", jit.Ptr(_IC, -5), _DI) // LEAQ -5(IC), DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_ARRAY **/
self.Link("_decode_V_ARRAY") // _decode_V_ARRAY
self.Emit("MOVL", jit.Imm(_S_vmask), _DX) // MOVL _S_vmask, DX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX) // BTQ AX, DX
self.Sjmp("JNC" , "_invalid_char") // JNC _invalid_char
/* create a new array */
self.Emit("MOVQ", _T_eface, _AX) // MOVQ _T_eface, AX
self.Emit("MOVQ", jit.Imm(_A_init_len), _BX) // MOVQ _A_init_len, BX
self.Emit("MOVQ", jit.Imm(_A_init_cap), _CX) // MOVQ _A_init_cap, CX
self.call_go(_F_makeslice) // CALL_GO runtime.makeslice
/* pack into an interface */
self.Emit("MOVQ", jit.Imm(_A_init_len), _BX) // MOVQ _A_init_len, BX
self.Emit("MOVQ", jit.Imm(_A_init_cap), _CX) // MOVQ _A_init_cap, CX
self.call_go(_F_convTslice) // CALL_GO runtime.convTslice
self.Emit("MOVQ", _AX, _R8) // MOVQ AX, R8
/* replace current state with an array */
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Imm(_S_arr), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_arr, ST.Vt[CX]
self.Emit("MOVQ", _T_slice, _AX) // MOVQ _T_slice, AX
self.Emit("MOVQ", _AX, jit.Ptr(_SI, 0)) // MOVQ AX, (SI)
self.WriteRecNotAX(2, _R8, jit.Ptr(_SI, 8), false) // MOVQ R8, 8(SI)
/* add a new slot for the first element */
self.Emit("ADDQ", jit.Imm(1), _CX) // ADDQ $1, CX
self.Emit("CMPQ", _CX, jit.Imm(types.MAX_RECURSE)) // CMPQ CX, ${types.MAX_RECURSE}
self.Sjmp("JAE" , "_stack_overflow") // JA _stack_overflow
self.Emit("MOVQ", jit.Ptr(_R8, 0), _AX) // MOVQ (R8), AX
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.WritePtrAX(3, jit.Sib(_ST, _CX, 8, _ST_Vp), false) // MOVQ AX, ST.Vp[CX]
self.Emit("MOVQ", jit.Imm(_S_arr_0), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_arr_0, ST.Vt[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/** V_OBJECT **/
self.Link("_decode_V_OBJECT") // _decode_V_OBJECT:
self.Emit("MOVL", jit.Imm(_S_vmask), _DX) // MOVL _S_vmask, DX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DX) // BTQ AX, DX
self.Sjmp("JNC" , "_invalid_char") // JNC _invalid_char
self.call_go(_F_makemap_small) // CALL_GO runtime.makemap_small
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Imm(_S_obj_0), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_obj_0, ST.Vt[CX]
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", _T_map, _DX) // MOVQ _T_map, DX
self.Emit("MOVQ", _DX, jit.Ptr(_SI, 0)) // MOVQ DX, (SI)
self.WritePtrAX(4, jit.Ptr(_SI, 8), false) // MOVQ AX, 8(SI)
self.Sjmp("JMP" , "_next") // JMP _next
/** V_STRING **/
self.Link("_decode_V_STRING") // _decode_V_STRING:
self.Emit("MOVQ", _VAR_ss_Iv, _CX) // MOVQ ss.Iv, CX
self.Emit("MOVQ", _IC, _AX) // MOVQ IC, AX
self.Emit("SUBQ", _CX, _AX) // SUBQ CX, AX
/* check for escapes */
self.Emit("CMPQ", _VAR_ss_Ep, jit.Imm(-1)) // CMPQ ss.Ep, $-1
self.Sjmp("JNE" , "_unquote") // JNE _unquote
self.Emit("SUBQ", jit.Imm(1), _AX) // SUBQ $1, AX
self.Emit("LEAQ", jit.Sib(_IP, _CX, 1, 0), _R8) // LEAQ (IP)(CX), R8
self.Byte(0x48, 0x8d, 0x3d) // LEAQ (PC), DI
self.Sref("_copy_string_end", 4)
self.Emit("BTQ", jit.Imm(_F_copy_string), _VAR_df)
self.Sjmp("JC", "copy_string")
self.Link("_copy_string_end")
self.Emit("XORL", _DX, _DX)
/* strings with no escape sequences */
self.Link("_noescape") // _noescape:
self.Emit("MOVL", jit.Imm(_S_omask_key), _DI) // MOVL _S_omask, DI
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _SI) // MOVQ ST.Vt[CX], SI
self.Emit("BTQ" , _SI, _DI) // BTQ SI, DI
self.Sjmp("JC" , "_object_key") // JC _object_key
/* check for pre-packed strings, avoid 1 allocation */
self.Emit("TESTQ", _DX, _DX) // TESTQ DX, DX
self.Sjmp("JNZ" , "_packed_str") // JNZ _packed_str
self.Emit("MOVQ" , _AX, _BX) // MOVQ AX, BX
self.Emit("MOVQ" , _R8, _AX) // MOVQ R8, AX
self.call_go(_F_convTstring) // CALL_GO runtime.convTstring
self.Emit("MOVQ" , _AX, _R9) // MOVQ AX, R9
/* packed string already in R9 */
self.Link("_packed_str") // _packed_str:
self.Emit("MOVQ", _T_string, _R8) // MOVQ _T_string, R8
self.Emit("MOVQ", _VAR_ss_Iv, _DI) // MOVQ ss.Iv, DI
self.Emit("SUBQ", jit.Imm(1), _DI) // SUBQ $1, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/* the string is an object key, get the map */
self.Link("_object_key")
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
/* add a new delimiter */
self.Emit("ADDQ", jit.Imm(1), _CX) // ADDQ $1, CX
self.Emit("CMPQ", _CX, jit.Imm(types.MAX_RECURSE)) // CMPQ CX, ${types.MAX_RECURSE}
self.Sjmp("JAE" , "_stack_overflow") // JA _stack_overflow
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.Emit("MOVQ", jit.Imm(_S_obj_delim), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_obj_delim, ST.Vt[CX]
/* add a new slot int the map */
self.Emit("MOVQ", _AX, _DI) // MOVQ AX, DI
self.Emit("MOVQ", _T_map, _AX) // MOVQ _T_map, AX
self.Emit("MOVQ", _SI, _BX) // MOVQ SI, BX
self.Emit("MOVQ", _R8, _CX) // MOVQ R9, CX
self.call_go(_F_mapassign_faststr) // CALL_GO runtime.mapassign_faststr
/* add to the pointer stack */
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.WritePtrAX(6, jit.Sib(_ST, _CX, 8, _ST_Vp), false) // MOVQ AX, ST.Vp[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/* allocate memory to store the string header and unquoted result */
self.Link("_unquote") // _unquote:
self.Emit("ADDQ", jit.Imm(15), _AX) // ADDQ $15, AX
self.Emit("MOVQ", _T_byte, _BX) // MOVQ _T_byte, BX
self.Emit("MOVB", jit.Imm(0), _CX) // MOVB $0, CX
self.call_go(_F_mallocgc) // CALL_GO runtime.mallocgc
self.Emit("MOVQ", _AX, _R9) // MOVQ AX, R9
/* prepare the unquoting parameters */
self.Emit("MOVQ" , _VAR_ss_Iv, _CX) // MOVQ ss.Iv, CX
self.Emit("LEAQ" , jit.Sib(_IP, _CX, 1, 0), _DI) // LEAQ (IP)(CX), DI
self.Emit("NEGQ" , _CX) // NEGQ CX
self.Emit("LEAQ" , jit.Sib(_IC, _CX, 1, -1), _SI) // LEAQ -1(IC)(CX), SI
self.Emit("LEAQ" , jit.Ptr(_R9, 16), _DX) // LEAQ 16(R8), DX
self.Emit("LEAQ" , _VAR_ss_Ep, _CX) // LEAQ ss.Ep, CX
self.Emit("XORL" , _R8, _R8) // XORL R8, R8
self.Emit("BTQ" , jit.Imm(_F_disable_urc), _VAR_df) // BTQ ${_F_disable_urc}, fv
self.Emit("SETCC", _R8) // SETCC R8
self.Emit("SHLQ" , jit.Imm(types.B_UNICODE_REPLACE), _R8) // SHLQ ${types.B_UNICODE_REPLACE}, R8
/* unquote the string, with R9 been preserved */
self.Emit("MOVQ", _R9, _VAR_R9) // SAVE R9
self.call_c(_F_unquote) // CALL unquote
self.Emit("MOVQ", _VAR_R9, _R9) // LOAD R9
/* check for errors */
self.Emit("TESTQ", _AX, _AX) // TESTQ AX, AX
self.Sjmp("JS" , "_unquote_error") // JS _unquote_error
self.Emit("MOVL" , jit.Imm(1), _DX) // MOVL $1, DX
self.Emit("LEAQ" , jit.Ptr(_R9, 16), _R8) // ADDQ $16, R8
self.Emit("MOVQ" , _R8, jit.Ptr(_R9, 0)) // MOVQ R8, (R9)
self.Emit("MOVQ" , _AX, jit.Ptr(_R9, 8)) // MOVQ AX, 8(R9)
self.Sjmp("JMP" , "_noescape") // JMP _noescape
/** V_DOUBLE **/
self.Link("_decode_V_DOUBLE") // _decode_V_DOUBLE:
self.Emit("BTQ" , jit.Imm(_F_use_number), _VAR_df) // BTQ _F_use_number, df
self.Sjmp("JC" , "_use_number") // JC _use_number
self.Emit("MOVSD", _VAR_ss_Dv, _X0) // MOVSD ss.Dv, X0
self.Sjmp("JMP" , "_use_float64") // JMP _use_float64
/** V_INTEGER **/
self.Link("_decode_V_INTEGER") // _decode_V_INTEGER:
self.Emit("BTQ" , jit.Imm(_F_use_number), _VAR_df) // BTQ _F_use_number, df
self.Sjmp("JC" , "_use_number") // JC _use_number
self.Emit("BTQ" , jit.Imm(_F_use_int64), _VAR_df) // BTQ _F_use_int64, df
self.Sjmp("JC" , "_use_int64") // JC _use_int64
//TODO: use ss.Dv directly
self.Emit("MOVSD", _VAR_ss_Dv, _X0) // MOVSD ss.Dv, X0
/* represent numbers as `float64` */
self.Link("_use_float64") // _use_float64:
self.Emit("MOVQ" , _X0, _AX) // MOVQ X0, AX
self.call_go(_F_convT64) // CALL_GO runtime.convT64
self.Emit("MOVQ" , _T_float64, _R8) // MOVQ _T_float64, R8
self.Emit("MOVQ" , _AX, _R9) // MOVQ AX, R9
self.Emit("MOVQ" , _VAR_ss_Ep, _DI) // MOVQ ss.Ep, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/* represent numbers as `json.Number` */
self.Link("_use_number") // _use_number
self.Emit("MOVQ", _VAR_ss_Ep, _AX) // MOVQ ss.Ep, AX
self.Emit("LEAQ", jit.Sib(_IP, _AX, 1, 0), _SI) // LEAQ (IP)(AX), SI
self.Emit("MOVQ", _IC, _CX) // MOVQ IC, CX
self.Emit("SUBQ", _AX, _CX) // SUBQ AX, CX
self.Emit("MOVQ", _SI, _AX) // MOVQ SI, AX
self.Emit("MOVQ", _CX, _BX) // MOVQ CX, BX
self.call_go(_F_convTstring) // CALL_GO runtime.convTstring
self.Emit("MOVQ", _T_number, _R8) // MOVQ _T_number, R8
self.Emit("MOVQ", _AX, _R9) // MOVQ AX, R9
self.Emit("MOVQ", _VAR_ss_Ep, _DI) // MOVQ ss.Ep, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/* represent numbers as `int64` */
self.Link("_use_int64") // _use_int64:
self.Emit("MOVQ", _VAR_ss_Iv, _AX) // MOVQ ss.Iv, AX
self.call_go(_F_convT64) // CALL_GO runtime.convT64
self.Emit("MOVQ", _T_int64, _R8) // MOVQ _T_int64, R8
self.Emit("MOVQ", _AX, _R9) // MOVQ AX, R9
self.Emit("MOVQ", _VAR_ss_Ep, _DI) // MOVQ ss.Ep, DI
self.Sjmp("JMP" , "_set_value") // JMP _set_value
/** V_KEY_SEP **/
self.Link("_decode_V_KEY_SEP") // _decode_V_KEY_SEP:
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("CMPQ", _AX, jit.Imm(_S_obj_delim)) // CMPQ AX, _S_obj_delim
self.Sjmp("JNE" , "_invalid_char") // JNE _invalid_char
self.Emit("MOVQ", jit.Imm(_S_val), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_val, ST.Vt[CX]
self.Emit("MOVQ", jit.Imm(_S_obj), jit.Sib(_ST, _CX, 8, _ST_Vt - 8)) // MOVQ _S_obj, ST.Vt[CX - 1]
self.Sjmp("JMP" , "_next") // JMP _next
/** V_ELEM_SEP **/
self.Link("_decode_V_ELEM_SEP") // _decode_V_ELEM_SEP:
self.Emit("MOVQ" , jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ" , jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("CMPQ" , _AX, jit.Imm(_S_arr))
self.Sjmp("JE" , "_array_sep") // JZ _next
self.Emit("CMPQ" , _AX, jit.Imm(_S_obj)) // CMPQ _AX, _S_arr
self.Sjmp("JNE" , "_invalid_char") // JNE _invalid_char
self.Emit("MOVQ" , jit.Imm(_S_obj_sep), jit.Sib(_ST, _CX, 8, _ST_Vt))
self.Sjmp("JMP" , "_next") // JMP _next
/* arrays */
self.Link("_array_sep")
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _DX) // MOVQ 8(SI), DX
self.Emit("CMPQ", _DX, jit.Ptr(_SI, 16)) // CMPQ DX, 16(SI)
self.Sjmp("JAE" , "_array_more") // JAE _array_more
/* add a slot for the new element */
self.Link("_array_append") // _array_append:
self.Emit("ADDQ", jit.Imm(1), jit.Ptr(_SI, 8)) // ADDQ $1, 8(SI)
self.Emit("MOVQ", jit.Ptr(_SI, 0), _SI) // MOVQ (SI), SI
self.Emit("ADDQ", jit.Imm(1), _CX) // ADDQ $1, CX
self.Emit("CMPQ", _CX, jit.Imm(types.MAX_RECURSE)) // CMPQ CX, ${types.MAX_RECURSE}
self.Sjmp("JAE" , "_stack_overflow") // JA _stack_overflow
self.Emit("SHLQ", jit.Imm(1), _DX) // SHLQ $1, DX
self.Emit("LEAQ", jit.Sib(_SI, _DX, 8, 0), _SI) // LEAQ (SI)(DX*8), SI
self.Emit("MOVQ", _CX, jit.Ptr(_ST, _ST_Sp)) // MOVQ CX, ST.Sp
self.WriteRecNotAX(7 , _SI, jit.Sib(_ST, _CX, 8, _ST_Vp), false) // MOVQ SI, ST.Vp[CX]
self.Emit("MOVQ", jit.Imm(_S_val), jit.Sib(_ST, _CX, 8, _ST_Vt)) // MOVQ _S_val, ST.Vt[CX}
self.Sjmp("JMP" , "_next") // JMP _next
/** V_ARRAY_END **/
self.Link("_decode_V_ARRAY_END") // _decode_V_ARRAY_END:
self.Emit("XORL", _DX, _DX) // XORL DX, DX
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("CMPQ", _AX, jit.Imm(_S_arr_0)) // CMPQ AX, _S_arr_0
self.Sjmp("JE" , "_first_item") // JE _first_item
self.Emit("CMPQ", _AX, jit.Imm(_S_arr)) // CMPQ AX, _S_arr
self.Sjmp("JNE" , "_invalid_char") // JNE _invalid_char
self.Emit("SUBQ", jit.Imm(1), jit.Ptr(_ST, _ST_Sp)) // SUBQ $1, ST.Sp
self.Emit("MOVQ", _DX, jit.Sib(_ST, _CX, 8, _ST_Vp)) // MOVQ DX, ST.Vp[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/* first element of an array */
self.Link("_first_item") // _first_item:
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("SUBQ", jit.Imm(2), jit.Ptr(_ST, _ST_Sp)) // SUBQ $2, ST.Sp
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp - 8), _SI) // MOVQ ST.Vp[CX - 1], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
self.Emit("MOVQ", _DX, jit.Sib(_ST, _CX, 8, _ST_Vp - 8)) // MOVQ DX, ST.Vp[CX - 1]
self.Emit("MOVQ", _DX, jit.Sib(_ST, _CX, 8, _ST_Vp)) // MOVQ DX, ST.Vp[CX]
self.Emit("MOVQ", _DX, jit.Ptr(_SI, 8)) // MOVQ DX, 8(SI)
self.Sjmp("JMP" , "_next") // JMP _next
/** V_OBJECT_END **/
self.Link("_decode_V_OBJECT_END") // _decode_V_OBJECT_END:
self.Emit("MOVL", jit.Imm(_S_omask_end), _DI) // MOVL _S_omask, DI
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vt), _AX) // MOVQ ST.Vt[CX], AX
self.Emit("BTQ" , _AX, _DI)
self.Sjmp("JNC" , "_invalid_char") // JNE _invalid_char
self.Emit("XORL", _AX, _AX) // XORL AX, AX
self.Emit("SUBQ", jit.Imm(1), jit.Ptr(_ST, _ST_Sp)) // SUBQ $1, ST.Sp
self.Emit("MOVQ", _AX, jit.Sib(_ST, _CX, 8, _ST_Vp)) // MOVQ AX, ST.Vp[CX]
self.Sjmp("JMP" , "_next") // JMP _next
/* return from decoder */
self.Link("_return") // _return:
self.Emit("XORL", _EP, _EP) // XORL EP, EP
self.Emit("MOVQ", _EP, jit.Ptr(_ST, _ST_Vp)) // MOVQ EP, ST.Vp[0]
self.Link("_epilogue") // _epilogue:
self.Emit("SUBQ", jit.Imm(_FsmOffset), _ST) // SUBQ _FsmOffset, _ST
self.Emit("MOVQ", jit.Ptr(_SP, _VD_offs), _BP) // MOVQ _VD_offs(SP), BP
self.Emit("ADDQ", jit.Imm(_VD_size), _SP) // ADDQ $_VD_size, SP
self.Emit("RET") // RET
/* array expand */
self.Link("_array_more") // _array_more:
self.Emit("MOVQ" , _T_eface, _AX) // MOVQ _T_eface, AX
self.Emit("MOVQ" , jit.Ptr(_SI, 0), _BX) // MOVQ (SI), BX
self.Emit("MOVQ" , jit.Ptr(_SI, 8), _CX) // MOVQ 8(SI), CX
self.Emit("MOVQ" , jit.Ptr(_SI, 16), _DI) // MOVQ 16(SI), DI
self.Emit("MOVQ" , _DI, _SI) // MOVQ DI, 24(SP)
self.Emit("SHLQ" , jit.Imm(1), _SI) // SHLQ $1, SI
self.call_go(_F_growslice) // CALL_GO runtime.growslice
self.Emit("MOVQ" , _AX, _DI) // MOVQ AX, DI
self.Emit("MOVQ" , _BX, _DX) // MOVQ BX, DX
self.Emit("MOVQ" , _CX, _AX) // MOVQ CX, AX
/* update the slice */
self.Emit("MOVQ", jit.Ptr(_ST, _ST_Sp), _CX) // MOVQ ST.Sp, CX
self.Emit("MOVQ", jit.Sib(_ST, _CX, 8, _ST_Vp), _SI) // MOVQ ST.Vp[CX], SI
self.Emit("MOVQ", jit.Ptr(_SI, 8), _SI) // MOVQ 8(SI), SI
self.Emit("MOVQ", _DX, jit.Ptr(_SI, 8)) // MOVQ DX, 8(SI)
self.Emit("MOVQ", _AX, jit.Ptr(_SI, 16)) // MOVQ AX, 16(AX)
self.WriteRecNotAX(8 , _DI, jit.Ptr(_SI, 0), false) // MOVQ R10, (SI)
self.Sjmp("JMP" , "_array_append") // JMP _array_append
/* copy string */
self.Link("copy_string") // pointer: R8, length: AX, return addr: DI
self.Emit("MOVQ", _R8, _VAR_cs_p)
self.Emit("MOVQ", _AX, _VAR_cs_n)
self.Emit("MOVQ", _DI, _VAR_cs_LR)
self.Emit("MOVQ", _AX, _BX)
self.Emit("MOVQ", _AX, _CX)
self.Emit("MOVQ", _T_byte, _AX)
self.call_go(_F_makeslice)
self.Emit("MOVQ", _AX, _VAR_cs_d)
self.Emit("MOVQ", _VAR_cs_p, _BX)
self.Emit("MOVQ", _VAR_cs_n, _CX)
self.call_go(_F_memmove)
self.Emit("MOVQ", _VAR_cs_d, _R8)
self.Emit("MOVQ", _VAR_cs_n, _AX)
self.Emit("MOVQ", _VAR_cs_LR, _DI)
self.Rjmp("JMP", _DI)
/* error handlers */
self.Link("_stack_overflow")
self.Emit("MOVL" , _E_recurse, _EP) // MOVQ _E_recurse, EP
self.Sjmp("JMP" , "_error") // JMP _error
self.Link("_vtype_error") // _vtype_error:
self.Emit("MOVQ" , _DI, _IC) // MOVQ DI, IC
self.Emit("MOVL" , _E_invalid, _EP) // MOVL _E_invalid, EP
self.Sjmp("JMP" , "_error") // JMP _error
self.Link("_invalid_char") // _invalid_char:
self.Emit("SUBQ" , jit.Imm(1), _IC) // SUBQ $1, IC
self.Emit("MOVL" , _E_invalid, _EP) // MOVL _E_invalid, EP
self.Sjmp("JMP" , "_error") // JMP _error
self.Link("_unquote_error") // _unquote_error:
self.Emit("MOVQ" , _VAR_ss_Iv, _IC) // MOVQ ss.Iv, IC
self.Emit("SUBQ" , jit.Imm(1), _IC) // SUBQ $1, IC
self.Link("_parsing_error") // _parsing_error:
self.Emit("NEGQ" , _AX) // NEGQ AX
self.Emit("MOVQ" , _AX, _EP) // MOVQ AX, EP
self.Link("_error") // _error:
self.Emit("PXOR" , _X0, _X0) // PXOR X0, X0
self.Emit("MOVOU", _X0, jit.Ptr(_VP, 0)) // MOVOU X0, (VP)
self.Sjmp("JMP" , "_epilogue") // JMP _epilogue
/* invalid value type, never returns */
self.Link("_invalid_vtype")
self.call_go(_F_invalid_vtype) // CALL invalid_type
self.Emit("UD2") // UD2
/* switch jump table */
self.Link("_switch_table") // _switch_table:
self.Sref("_decode_V_EOF", 0) // SREF &_decode_V_EOF, $0
self.Sref("_decode_V_NULL", -4) // SREF &_decode_V_NULL, $-4
self.Sref("_decode_V_TRUE", -8) // SREF &_decode_V_TRUE, $-8
self.Sref("_decode_V_FALSE", -12) // SREF &_decode_V_FALSE, $-12
self.Sref("_decode_V_ARRAY", -16) // SREF &_decode_V_ARRAY, $-16
self.Sref("_decode_V_OBJECT", -20) // SREF &_decode_V_OBJECT, $-20
self.Sref("_decode_V_STRING", -24) // SREF &_decode_V_STRING, $-24
self.Sref("_decode_V_DOUBLE", -28) // SREF &_decode_V_DOUBLE, $-28
self.Sref("_decode_V_INTEGER", -32) // SREF &_decode_V_INTEGER, $-32
self.Sref("_decode_V_KEY_SEP", -36) // SREF &_decode_V_KEY_SEP, $-36
self.Sref("_decode_V_ELEM_SEP", -40) // SREF &_decode_V_ELEM_SEP, $-40
self.Sref("_decode_V_ARRAY_END", -44) // SREF &_decode_V_ARRAY_END, $-44
self.Sref("_decode_V_OBJECT_END", -48) // SREF &_decode_V_OBJECT_END, $-48
/* fast character lookup table */
self.Link("_decode_tab") // _decode_tab:
self.Sref("_decode_V_EOF", 0) // SREF &_decode_V_EOF, $0
/* generate rest of the tabs */
for i := 1; i < 256; i++ {
if to, ok := _R_tab[i]; ok {
self.Sref(to, -int64(i) * 4)
} else {
self.Byte(0x00, 0x00, 0x00, 0x00)
}
}
}
func (self *_ValueDecoder) WritePtrAX(i int, rec obj.Addr, saveDI bool) {
self.Emit("MOVQ", _V_writeBarrier, _R9)
self.Emit("CMPL", jit.Ptr(_R9, 0), jit.Imm(0))
self.Sjmp("JE", "_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
if saveDI {
self.save(_DI)
}
self.Emit("LEAQ", rec, _DI)
self.call(_F_gcWriteBarrierAX)
if saveDI {
self.load(_DI)
}
self.Sjmp("JMP", "_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Link("_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Emit("MOVQ", _AX, rec)
self.Link("_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
}
func (self *_ValueDecoder) WriteRecNotAX(i int, ptr obj.Addr, rec obj.Addr, saveDI bool) {
if rec.Reg == x86.REG_AX || rec.Index == x86.REG_AX {
panic("rec contains AX!")
}
self.Emit("MOVQ", _V_writeBarrier, _AX)
self.Emit("CMPL", jit.Ptr(_AX, 0), jit.Imm(0))
self.Sjmp("JE", "_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Emit("MOVQ", ptr, _AX)
if saveDI {
self.save(_DI)
}
self.Emit("LEAQ", rec, _DI)
self.call(_F_gcWriteBarrierAX)
if saveDI {
self.load(_DI)
}
self.Sjmp("JMP", "_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Link("_no_writeBarrier" + strconv.Itoa(i) + "_{n}")
self.Emit("MOVQ", ptr, rec)
self.Link("_end_writeBarrier" + strconv.Itoa(i) + "_{n}")
}
/** Generic Decoder **/
var (
_subr_decode_value = new(_ValueDecoder).build()
)
//go:nosplit
func invalid_vtype(vt types.ValueType) {
throw(fmt.Sprintf("invalid value type: %d", vt))
}

View File

@@ -1,37 +0,0 @@
// +build go1.17,!go1.21
//
// Copyright 2021 ByteDance Inc.
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
// You may obtain a copy of the License at
//
// http://www.apache.org/licenses/LICENSE-2.0
//
// Unless required by applicable law or agreed to in writing, software
// distributed under the License is distributed on an "AS IS" BASIS,
// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
// See the License for the specific language governing permissions and
// limitations under the License.
//
#include "go_asm.h"
#include "funcdata.h"
#include "textflag.h"
TEXT ·decodeValueStub(SB), NOSPLIT, $0 - 72
NO_LOCAL_POINTERS
PXOR X0, X0
MOVOU X0, rv+48(FP)
MOVQ st+0(FP) , R13
MOVQ sp+8(FP) , R10
MOVQ sn+16(FP), R12
MOVQ ic+24(FP), R11
MOVQ vp+32(FP), R15
MOVQ df+40(FP), AX
MOVQ ·_subr_decode_value(SB), BX
CALL BX
MOVQ R11, rp+48(FP)
MOVQ BX, ex+56(FP)
RET

View File

@@ -1,37 +0,0 @@
// +build go1.15,!go1.17
//
// Copyright 2021 ByteDance Inc.
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
// You may obtain a copy of the License at
//
// http://www.apache.org/licenses/LICENSE-2.0
//
// Unless required by applicable law or agreed to in writing, software
// distributed under the License is distributed on an "AS IS" BASIS,
// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
// See the License for the specific language governing permissions and
// limitations under the License.
//
#include "go_asm.h"
#include "funcdata.h"
#include "textflag.h"
TEXT ·decodeValueStub(SB), NOSPLIT, $0 - 72
NO_LOCAL_POINTERS
PXOR X0, X0
MOVOU X0, rv+48(FP)
MOVQ st+0(FP), BX
MOVQ sp+8(FP), R12
MOVQ sn+16(FP), R13
MOVQ ic+24(FP), R14
MOVQ vp+32(FP), R15
MOVQ df+40(FP), R10
MOVQ ·_subr_decode_value(SB), AX
CALL AX
MOVQ R14, rp+48(FP)
MOVQ R11, ex+56(FP)
RET

View File

@@ -29,7 +29,7 @@ const (
_MinSlice = 2
_MaxStack = 4096 // 4k slots
_MaxStackBytes = _MaxStack * _PtrBytes
_MaxDigitNums = 800 // used in atof fallback algorithm
_MaxDigitNums = types.MaxDigitNums // used in atof fallback algorithm
)
const (

View File

@@ -21,8 +21,9 @@ import (
`io`
`sync`
`github.com/bytedance/sonic/option`
`github.com/bytedance/sonic/internal/native`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/option`
)
var (
@@ -71,6 +72,7 @@ func (self *StreamDecoder) Decode(val interface{}) (err error) {
var first = true
var repeat = true
read_more:
for {
l := len(buf)
@@ -97,11 +99,20 @@ read_more:
l := len(buf)
if l > 0 {
self.Decoder.Reset(string(buf))
var x int
if ret := native.SkipOneFast(&self.s, &x); ret < 0 {
if repeat {
goto read_more
} else {
err = SyntaxError{x, self.s, types.ParsingError(-ret), ""}
self.err = err
return
}
}
err = self.Decoder.Decode(val)
if err != nil {
if repeat && self.repeatable(err) {
goto read_more
}
self.err = err
}

View File

@@ -1,111 +0,0 @@
// +build go1.15,!go1.20
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package decoder
import (
`unsafe`
`reflect`
_ `github.com/chenzhuoyu/base64x`
`github.com/bytedance/sonic/internal/rt`
)
//go:linkname _subr__b64decode github.com/chenzhuoyu/base64x._subr__b64decode
var _subr__b64decode uintptr
// runtime.maxElementSize
const _max_map_element_size uintptr = 128
func mapfast(vt reflect.Type) bool {
return vt.Elem().Size() <= _max_map_element_size
}
//go:nosplit
//go:linkname throw runtime.throw
//goland:noinspection GoUnusedParameter
func throw(s string)
//go:linkname convT64 runtime.convT64
//goland:noinspection GoUnusedParameter
func convT64(v uint64) unsafe.Pointer
//go:linkname convTslice runtime.convTslice
//goland:noinspection GoUnusedParameter
func convTslice(v []byte) unsafe.Pointer
//go:linkname convTstring runtime.convTstring
//goland:noinspection GoUnusedParameter
func convTstring(v string) unsafe.Pointer
//go:noescape
//go:linkname memequal runtime.memequal
//goland:noinspection GoUnusedParameter
func memequal(a unsafe.Pointer, b unsafe.Pointer, size uintptr) bool
//go:noescape
//go:linkname memmove runtime.memmove
//goland:noinspection GoUnusedParameter
func memmove(to unsafe.Pointer, from unsafe.Pointer, n uintptr)
//go:linkname mallocgc runtime.mallocgc
//goland:noinspection GoUnusedParameter
func mallocgc(size uintptr, typ *rt.GoType, needzero bool) unsafe.Pointer
//go:linkname makeslice runtime.makeslice
//goland:noinspection GoUnusedParameter
func makeslice(et *rt.GoType, len int, cap int) unsafe.Pointer
//go:noescape
//go:linkname growslice runtime.growslice
//goland:noinspection GoUnusedParameter
func growslice(et *rt.GoType, old rt.GoSlice, cap int) rt.GoSlice
//go:linkname makemap_small runtime.makemap_small
func makemap_small() unsafe.Pointer
//go:linkname mapassign runtime.mapassign
//goland:noinspection GoUnusedParameter
func mapassign(t *rt.GoType, h unsafe.Pointer, k unsafe.Pointer) unsafe.Pointer
//go:linkname mapassign_fast32 runtime.mapassign_fast32
//goland:noinspection GoUnusedParameter
func mapassign_fast32(t *rt.GoType, h unsafe.Pointer, k uint32) unsafe.Pointer
//go:linkname mapassign_fast64 runtime.mapassign_fast64
//goland:noinspection GoUnusedParameter
func mapassign_fast64(t *rt.GoType, h unsafe.Pointer, k uint64) unsafe.Pointer
//go:linkname mapassign_fast64ptr runtime.mapassign_fast64ptr
//goland:noinspection GoUnusedParameter
func mapassign_fast64ptr(t *rt.GoType, h unsafe.Pointer, k unsafe.Pointer) unsafe.Pointer
//go:linkname mapassign_faststr runtime.mapassign_faststr
//goland:noinspection GoUnusedParameter
func mapassign_faststr(t *rt.GoType, h unsafe.Pointer, s string) unsafe.Pointer
//go:nosplit
//go:linkname memclrHasPointers runtime.memclrHasPointers
//goland:noinspection GoUnusedParameter
func memclrHasPointers(ptr unsafe.Pointer, n uintptr)
//go:noescape
//go:linkname memclrNoHeapPointers runtime.memclrNoHeapPointers
//goland:noinspection GoUnusedParameter
func memclrNoHeapPointers(ptr unsafe.Pointer, n uintptr)

View File

@@ -82,23 +82,23 @@ func makemap_small() unsafe.Pointer
//go:linkname mapassign runtime.mapassign
//goland:noinspection GoUnusedParameter
func mapassign(t *rt.GoType, h unsafe.Pointer, k unsafe.Pointer) unsafe.Pointer
func mapassign(t *rt.GoMapType, h unsafe.Pointer, k unsafe.Pointer) unsafe.Pointer
//go:linkname mapassign_fast32 runtime.mapassign_fast32
//goland:noinspection GoUnusedParameter
func mapassign_fast32(t *rt.GoType, h unsafe.Pointer, k uint32) unsafe.Pointer
func mapassign_fast32(t *rt.GoMapType, h unsafe.Pointer, k uint32) unsafe.Pointer
//go:linkname mapassign_fast64 runtime.mapassign_fast64
//goland:noinspection GoUnusedParameter
func mapassign_fast64(t *rt.GoType, h unsafe.Pointer, k uint64) unsafe.Pointer
func mapassign_fast64(t *rt.GoMapType, h unsafe.Pointer, k uint64) unsafe.Pointer
//go:linkname mapassign_fast64ptr runtime.mapassign_fast64ptr
//goland:noinspection GoUnusedParameter
func mapassign_fast64ptr(t *rt.GoType, h unsafe.Pointer, k unsafe.Pointer) unsafe.Pointer
func mapassign_fast64ptr(t *rt.GoMapType, h unsafe.Pointer, k unsafe.Pointer) unsafe.Pointer
//go:linkname mapassign_faststr runtime.mapassign_faststr
//goland:noinspection GoUnusedParameter
func mapassign_faststr(t *rt.GoType, h unsafe.Pointer, s string) unsafe.Pointer
func mapassign_faststr(t *rt.GoMapType, h unsafe.Pointer, s string) unsafe.Pointer
//go:nosplit
//go:linkname memclrHasPointers runtime.memclrHasPointers

File diff suppressed because it is too large Load Diff

File diff suppressed because it is too large Load Diff

View File

@@ -1,4 +1,4 @@
// +build go1.15,!go1.17
// +build go1.16,!go1.17
/*
* Copyright 2021 ByteDance Inc.

View File

@@ -1,4 +1,4 @@
// +build go1.17,!go1.21
// +build go1.17,!go1.22
/*
* Copyright 2021 ByteDance Inc.

View File

@@ -292,7 +292,6 @@ func Pretouch(vt reflect.Type, opts ...option.CompileOption) error {
cfg := option.DefaultCompileOptions()
for _, opt := range opts {
opt(&cfg)
break
}
return pretouchRec(map[reflect.Type]uint8{vt: 0}, cfg)
}

View File

@@ -1,4 +1,4 @@
// +build go1.15,!go1.17
// +build go1.16,!go1.17
/*
* Copyright 2021 ByteDance Inc.

View File

@@ -1,4 +1,4 @@
// +build go1.20
// +build go1.20,!go1.21
/*
* Copyright 2021 ByteDance Inc.

View File

@@ -1,124 +0,0 @@
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`reflect`
`sync`
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
//go:linkname lastmoduledatap runtime.lastmoduledatap
//goland:noinspection GoUnusedGlobalVariable
var lastmoduledatap *_ModuleData
//go:linkname moduledataverify1 runtime.moduledataverify1
func moduledataverify1(_ *_ModuleData)
// PCDATA and FUNCDATA table indexes.
//
// See funcdata.h and $GROOT/src/cmd/internal/objabi/funcdata.go.
const (
_FUNCDATA_ArgsPointerMaps = 0
_FUNCDATA_LocalsPointerMaps = 1
)
type funcInfo struct {
*_Func
datap *_ModuleData
}
//go:linkname findfunc runtime.findfunc
func findfunc(pc uintptr) funcInfo
//go:linkname funcdata runtime.funcdata
func funcdata(f funcInfo, i uint8) unsafe.Pointer
var (
modLock sync.Mutex
modList []*_ModuleData
)
var emptyByte byte
func encodeVariant(v int) []byte {
var u int
var r []byte
/* split every 7 bits */
for v > 127 {
u = v & 0x7f
v = v >> 7
r = append(r, byte(u) | 0x80)
}
/* check for last one */
if v == 0 {
return r
}
/* add the last one */
r = append(r, byte(v))
return r
}
func registerModule(mod *_ModuleData) {
modLock.Lock()
modList = append(modList, mod)
lastmoduledatap.next = mod
lastmoduledatap = mod
modLock.Unlock()
}
func stackMap(f interface{}) (args uintptr, locals uintptr) {
fv := reflect.ValueOf(f)
if fv.Kind() != reflect.Func {
panic("f must be reflect.Func kind!")
}
fi := findfunc(fv.Pointer())
return uintptr(funcdata(fi, uint8(_FUNCDATA_ArgsPointerMaps))), uintptr(funcdata(fi, uint8(_FUNCDATA_LocalsPointerMaps)))
}
var moduleCache = struct{
m map[*_ModuleData][]byte
l sync.Mutex
}{
m : make(map[*_ModuleData][]byte),
}
func cacheStackmap(argPtrs []bool, localPtrs []bool, mod *_ModuleData) (argptrs uintptr, localptrs uintptr) {
as := rt.StackMapBuilder{}
for _, b := range argPtrs {
as.AddField(b)
}
ab, _ := as.Build().MarshalBinary()
ls := rt.StackMapBuilder{}
for _, b := range localPtrs {
ls.AddField(b)
}
lb, _ := ls.Build().MarshalBinary()
cache := make([]byte, len(ab) + len(lb))
copy(cache, ab)
copy(cache[len(ab):], lb)
moduleCache.l.Lock()
moduleCache.m[mod] = cache
moduleCache.l.Unlock()
return uintptr(rt.IndexByte(cache, 0)), uintptr(rt.IndexByte(cache, len(ab)))
}

View File

@@ -1,169 +0,0 @@
// +build go1.15,!go1.16
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
type _Func struct {
entry uintptr // start pc
nameoff int32 // function name
args int32 // in/out args size
deferreturn uint32 // offset of start of a deferreturn call instruction from entry, if any.
pcsp int32
pcfile int32
pcln int32
npcdata int32
funcID uint8 // set for certain special runtime functions
_ [2]int8 // unused
nfuncdata uint8 // must be last
argptrs uintptr
localptrs uintptr
}
type _FuncTab struct {
entry uintptr
funcoff uintptr
}
type _BitVector struct {
n int32 // # of bits
bytedata *uint8
}
type _PtabEntry struct {
name int32
typ int32
}
type _TextSection struct {
vaddr uintptr // prelinked section vaddr
length uintptr // section length
baseaddr uintptr // relocated section address
}
type _ModuleData struct {
pclntable []byte
ftab []_FuncTab
filetab []uint32
findfunctab *_FindFuncBucket
minpc, maxpc uintptr
text, etext uintptr
noptrdata, enoptrdata uintptr
data, edata uintptr
bss, ebss uintptr
noptrbss, enoptrbss uintptr
end, gcdata, gcbss uintptr
types, etypes uintptr
textsectmap []_TextSection
typelinks []int32 // offsets from types
itablinks []*rt.GoItab
ptab []_PtabEntry
pluginpath string
pkghashes []byte
modulename string
modulehashes []byte
hasmain uint8 // 1 if module contains the main function, 0 otherwise
gcdatamask, gcbssmask _BitVector
typemap map[int32]*rt.GoType // offset to *_rtype in previous module
bad bool // module failed to load and should be ignored
next *_ModuleData
}
type _FindFuncBucket struct {
idx uint32
subbuckets [16]byte
}
var findFuncTab = &_FindFuncBucket {
idx: 1,
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argPtrs []bool, localPtrs []bool) {
mod := new(_ModuleData)
minpc := pc
maxpc := pc + size
/* build the PC & line table */
pclnt := []byte {
0xfb, 0xff, 0xff, 0xff, // magic : 0xfffffffb
0, // pad1 : 0
0, // pad2 : 0
1, // minLC : 1
4 << (^uintptr(0) >> 63), // ptrSize : 4 << (^uintptr(0) >> 63)
}
// cache arg and local stackmap
argptrs, localptrs := cacheStackmap(argPtrs, localPtrs, mod)
/* add the function name */
noff := len(pclnt)
pclnt = append(append(pclnt, name...), 0)
/* add PCDATA */
pcsp := len(pclnt)
pclnt = append(pclnt, encodeVariant((fp + 1) << 1)...)
pclnt = append(pclnt, encodeVariant(int(size))...)
/* function entry */
fnv := _Func {
entry : pc,
nameoff : int32(noff),
args : int32(args),
pcsp : int32(pcsp),
nfuncdata : 2,
argptrs : uintptr(argptrs),
localptrs : uintptr(localptrs),
}
/* align the func to 8 bytes */
if p := len(pclnt) % 8; p != 0 {
pclnt = append(pclnt, make([]byte, 8 - p)...)
}
/* add the function descriptor */
foff := len(pclnt)
pclnt = append(pclnt, (*(*[unsafe.Sizeof(_Func{})]byte)(unsafe.Pointer(&fnv)))[:]...)
/* function table */
tab := []_FuncTab {
{entry: pc, funcoff: uintptr(foff)},
{entry: pc, funcoff: uintptr(foff)},
{entry: maxpc},
}
/* module data */
*mod = _ModuleData {
pclntable : pclnt,
ftab : tab,
findfunctab : findFuncTab,
minpc : minpc,
maxpc : maxpc,
modulename : name,
gcdata: uintptr(unsafe.Pointer(&emptyByte)),
gcbss: uintptr(unsafe.Pointer(&emptyByte)),
}
/* verify and register the new module */
moduledataverify1(mod)
registerModule(mod)
}

View File

@@ -1,175 +0,0 @@
//go:build go1.16 && !go1.18
// +build go1.16,!go1.18
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`unsafe`
)
type _Func struct {
entry uintptr // start pc
nameoff int32 // function name
args int32 // in/out args size
deferreturn uint32 // offset of start of a deferreturn call instruction from entry, if any.
pcsp uint32
pcfile uint32
pcln uint32
npcdata uint32
cuOffset uint32 // runtime.cutab offset of this function's CU
funcID uint8 // set for certain special runtime functions
_ [2]byte // pad
nfuncdata uint8 // must be last
argptrs uintptr
localptrs uintptr
}
type _FuncTab struct {
entry uintptr
funcoff uintptr
}
type _PCHeader struct {
magic uint32 // 0xFFFFFFFA
pad1, pad2 uint8 // 0,0
minLC uint8 // min instruction size
ptrSize uint8 // size of a ptr in bytes
nfunc int // number of functions in the module
nfiles uint // number of entries in the file tab.
funcnameOffset uintptr // offset to the funcnametab variable from _PCHeader
cuOffset uintptr // offset to the cutab variable from _PCHeader
filetabOffset uintptr // offset to the filetab variable from _PCHeader
pctabOffset uintptr // offset to the pctab varible from _PCHeader
pclnOffset uintptr // offset to the pclntab variable from _PCHeader
}
type _BitVector struct {
n int32 // # of bits
bytedata *uint8
}
type _PtabEntry struct {
name int32
typ int32
}
type _TextSection struct {
vaddr uintptr // prelinked section vaddr
length uintptr // section length
baseaddr uintptr // relocated section address
}
type _ModuleData struct {
pcHeader *_PCHeader
funcnametab []byte
cutab []uint32
filetab []byte
pctab []byte
pclntable []_Func
ftab []_FuncTab
findfunctab *_FindFuncBucket
minpc, maxpc uintptr
text, etext uintptr
noptrdata, enoptrdata uintptr
data, edata uintptr
bss, ebss uintptr
noptrbss, enoptrbss uintptr
end, gcdata, gcbss uintptr
types, etypes uintptr
textsectmap []_TextSection
typelinks []int32
itablinks []unsafe.Pointer
ptab []_PtabEntry
pluginpath string
pkghashes []struct{}
modulename string
modulehashes []struct{}
hasmain uint8
gcdatamask, gcbssmask _BitVector
typemap map[int32]unsafe.Pointer
bad bool
next *_ModuleData
}
type _FindFuncBucket struct {
idx uint32
subbuckets [16]byte
}
var modHeader = &_PCHeader {
magic : 0xfffffffa,
minLC : 1,
nfunc : 1,
ptrSize : 4 << (^uintptr(0) >> 63),
}
var findFuncTab = &_FindFuncBucket {
idx: 1,
}
func makePCtab(fp int) []byte {
return append([]byte{0}, encodeVariant((fp + 1) << 1)...)
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argPtrs []bool, localPtrs []bool) {
mod := new(_ModuleData)
minpc := pc
maxpc := pc + size
// cache arg and local stackmap
argptrs, localptrs := cacheStackmap(argPtrs, localPtrs, mod)
/* function entry */
lnt := []_Func {{
entry : pc,
nameoff : 1,
args : int32(args),
pcsp : 1,
nfuncdata : 2,
argptrs : uintptr(argptrs),
localptrs : uintptr(localptrs),
}}
/* function table */
tab := []_FuncTab {
{entry: pc},
{entry: pc},
{entry: maxpc},
}
/* module data */
*mod = _ModuleData {
pcHeader : modHeader,
funcnametab : append(append([]byte{0}, name...), 0),
pctab : append(makePCtab(fp), encodeVariant(int(size))...),
pclntable : lnt,
ftab : tab,
findfunctab : findFuncTab,
minpc : minpc,
maxpc : maxpc,
modulename : name,
gcdata: uintptr(unsafe.Pointer(&emptyByte)),
gcbss: uintptr(unsafe.Pointer(&emptyByte)),
}
/* verify and register the new module */
moduledataverify1(mod)
registerModule(mod)
}

View File

@@ -1,201 +0,0 @@
// +build go1.18,!go1.20
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
// A FuncFlag holds bits about a function.
// This list must match the list in cmd/internal/objabi/funcid.go.
type funcFlag uint8
type _Func struct {
entryOff uint32 // start pc
nameoff int32 // function name
args int32 // in/out args size
deferreturn uint32 // offset of start of a deferreturn call instruction from entry, if any.
pcsp uint32
pcfile uint32
pcln uint32
npcdata uint32
cuOffset uint32 // runtime.cutab offset of this function's CU
funcID uint8 // set for certain special runtime functions
flag funcFlag
_ [1]byte // pad
nfuncdata uint8 // must be last
argptrs uint32
localptrs uint32
}
type _FuncTab struct {
entry uint32
funcoff uint32
}
type _PCHeader struct {
magic uint32 // 0xFFFFFFF0
pad1, pad2 uint8 // 0,0
minLC uint8 // min instruction size
ptrSize uint8 // size of a ptr in bytes
nfunc int // number of functions in the module
nfiles uint // number of entries in the file tab
textStart uintptr // base for function entry PC offsets in this module, equal to moduledata.text
funcnameOffset uintptr // offset to the funcnametab variable from pcHeader
cuOffset uintptr // offset to the cutab variable from pcHeader
filetabOffset uintptr // offset to the filetab variable from pcHeader
pctabOffset uintptr // offset to the pctab variable from pcHeader
pclnOffset uintptr // offset to the pclntab variable from pcHeader
}
type _BitVector struct {
n int32 // # of bits
bytedata *uint8
}
type _PtabEntry struct {
name int32
typ int32
}
type _TextSection struct {
vaddr uintptr // prelinked section vaddr
length uintptr // section length
baseaddr uintptr // relocated section address
}
type _ModuleData struct {
pcHeader *_PCHeader
funcnametab []byte
cutab []uint32
filetab []byte
pctab []byte
pclntable []byte
ftab []_FuncTab
findfunctab *_FindFuncBucket
minpc, maxpc uintptr
text, etext uintptr
noptrdata, enoptrdata uintptr
data, edata uintptr
bss, ebss uintptr
noptrbss, enoptrbss uintptr
end, gcdata, gcbss uintptr
types, etypes uintptr
rodata uintptr
gofunc uintptr
textsectmap []_TextSection
typelinks []int32
itablinks []unsafe.Pointer
ptab []_PtabEntry
pluginpath string
pkghashes []struct{}
modulename string
modulehashes []struct{}
hasmain uint8
gcdatamask, gcbssmask _BitVector
typemap map[int32]unsafe.Pointer
bad bool
next *_ModuleData
}
type _FindFuncBucket struct {
idx uint32
subbuckets [16]byte
}
func makePCtab(fp int) []byte {
return append([]byte{0}, encodeVariant((fp + 1) << 1)...)
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argPtrs []bool, localPtrs []bool) {
mod := new(_ModuleData)
minpc := pc
maxpc := pc + size
findFuncTab := make([]_FindFuncBucket, textSize/4096 + 1)
modHeader := &_PCHeader {
magic : 0xfffffff0,
minLC : 1,
nfunc : 1,
ptrSize : 4 << (^uintptr(0) >> 63),
textStart: minpc,
}
// cache arg and local stackmap
argptrs, localptrs := cacheStackmap(argPtrs, localPtrs, mod)
base := argptrs
if argptrs > localptrs {
base = localptrs
}
/* function entry */
lnt := []_Func {{
entryOff : 0,
nameoff : 1,
args : int32(args),
pcsp : 1,
nfuncdata : 2,
argptrs: uint32(argptrs - base),
localptrs: uint32(localptrs - base),
}}
nlnt := len(lnt)*int(unsafe.Sizeof(_Func{}))
plnt := unsafe.Pointer(&lnt[0])
/* function table */
ftab := []_FuncTab {
{entry : 0, funcoff : 16},
{entry : uint32(size)},
}
nftab := len(ftab)*int(unsafe.Sizeof(_FuncTab{}))
pftab := unsafe.Pointer(&ftab[0])
pclntab := make([]byte, 0, nftab + nlnt)
pclntab = append(pclntab, rt.BytesFrom(pftab, nftab, nftab)...)
pclntab = append(pclntab, rt.BytesFrom(plnt, nlnt, nlnt)...)
/* module data */
*mod = _ModuleData {
pcHeader : modHeader,
funcnametab : append(append([]byte{0}, name...), 0),
pctab : append(makePCtab(fp), encodeVariant(int(size))...),
pclntable : pclntab,
ftab : ftab,
text : minpc,
etext : pc + textSize,
findfunctab : &findFuncTab[0],
minpc : minpc,
maxpc : maxpc,
modulename : name,
gcdata: uintptr(unsafe.Pointer(&emptyByte)),
gcbss: uintptr(unsafe.Pointer(&emptyByte)),
gofunc: base,
}
/* verify and register the new module */
moduledataverify1(mod)
registerModule(mod)
}

View File

@@ -1,201 +0,0 @@
// +build go1.20
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
// A FuncFlag holds bits about a function.
// This list must match the list in cmd/internal/objabi/funcid.go.
type funcFlag uint8
type _Func struct {
entryOff uint32 // start pc
nameoff int32 // function name
args int32 // in/out args size
deferreturn uint32 // offset of start of a deferreturn call instruction from entry, if any.
pcsp uint32
pcfile uint32
pcln uint32
npcdata uint32
cuOffset uint32 // runtime.cutab offset of this function's CU
funcID uint8 // set for certain special runtime functions
flag funcFlag
_ [1]byte // pad
nfuncdata uint8 // must be last
argptrs uint32
localptrs uint32
}
type _FuncTab struct {
entry uint32
funcoff uint32
}
type _PCHeader struct {
magic uint32 // 0xFFFFFFF0
pad1, pad2 uint8 // 0,0
minLC uint8 // min instruction size
ptrSize uint8 // size of a ptr in bytes
nfunc int // number of functions in the module
nfiles uint // number of entries in the file tab
textStart uintptr // base for function entry PC offsets in this module, equal to moduledata.text
funcnameOffset uintptr // offset to the funcnametab variable from pcHeader
cuOffset uintptr // offset to the cutab variable from pcHeader
filetabOffset uintptr // offset to the filetab variable from pcHeader
pctabOffset uintptr // offset to the pctab variable from pcHeader
pclnOffset uintptr // offset to the pclntab variable from pcHeader
}
type _BitVector struct {
n int32 // # of bits
bytedata *uint8
}
type _PtabEntry struct {
name int32
typ int32
}
type _TextSection struct {
vaddr uintptr // prelinked section vaddr
length uintptr // section length
baseaddr uintptr // relocated section address
}
type _ModuleData struct {
pcHeader *_PCHeader
funcnametab []byte
cutab []uint32
filetab []byte
pctab []byte
pclntable []byte
ftab []_FuncTab
findfunctab *_FindFuncBucket
minpc, maxpc uintptr
text, etext uintptr
noptrdata, enoptrdata uintptr
data, edata uintptr
bss, ebss uintptr
noptrbss, enoptrbss uintptr
end, gcdata, gcbss uintptr
types, etypes uintptr
rodata uintptr
gofunc uintptr
textsectmap []_TextSection
typelinks []int32
itablinks []unsafe.Pointer
ptab []_PtabEntry
pluginpath string
pkghashes []struct{}
modulename string
modulehashes []struct{}
hasmain uint8
gcdatamask, gcbssmask _BitVector
typemap map[int32]unsafe.Pointer
bad bool
next *_ModuleData
}
type _FindFuncBucket struct {
idx uint32
subbuckets [16]byte
}
func makePCtab(fp int) []byte {
return append([]byte{0}, encodeVariant((fp + 1) << 1)...)
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argPtrs []bool, localPtrs []bool) {
mod := new(_ModuleData)
minpc := pc
maxpc := pc + size
findFuncTab := make([]_FindFuncBucket, textSize/4096 + 1)
modHeader := &_PCHeader {
magic : 0xfffffff0,
minLC : 1,
nfunc : 1,
ptrSize : 4 << (^uintptr(0) >> 63),
textStart: minpc,
}
// cache arg and local stackmap
argptrs, localptrs := cacheStackmap(argPtrs, localPtrs, mod)
base := argptrs
if argptrs > localptrs {
base = localptrs
}
/* function entry */
lnt := []_Func {{
entryOff : 0,
nameoff : 1,
args : int32(args),
pcsp : 1,
nfuncdata : 2,
argptrs: uint32(argptrs - base),
localptrs: uint32(localptrs - base),
}}
nlnt := len(lnt)*int(unsafe.Sizeof(_Func{}))
plnt := unsafe.Pointer(&lnt[0])
/* function table */
ftab := []_FuncTab {
{entry : 0, funcoff : 16},
{entry : uint32(size)},
}
nftab := len(ftab)*int(unsafe.Sizeof(_FuncTab{}))
pftab := unsafe.Pointer(&ftab[0])
pclntab := make([]byte, 0, nftab + nlnt)
pclntab = append(pclntab, rt.BytesFrom(pftab, nftab, nftab)...)
pclntab = append(pclntab, rt.BytesFrom(plnt, nlnt, nlnt)...)
/* module data */
*mod = _ModuleData {
pcHeader : modHeader,
funcnametab : append(append([]byte{0}, name...), 0),
pctab : append(makePCtab(fp), encodeVariant(int(size))...),
pclntable : pclntab,
ftab : ftab,
text : minpc,
etext : pc + textSize,
findfunctab : &findFuncTab[0],
minpc : minpc,
maxpc : maxpc,
modulename : name,
gcdata: uintptr(unsafe.Pointer(&emptyByte)),
gcbss: uintptr(unsafe.Pointer(&emptyByte)),
gofunc: base,
}
/* verify and register the new module */
moduledataverify1(mod)
registerModule(mod)
}

View File

@@ -1,74 +0,0 @@
//go:build darwin || linux
// +build darwin linux
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`fmt`
`os`
`reflect`
`syscall`
`unsafe`
)
const (
_AP = syscall.MAP_ANON | syscall.MAP_PRIVATE
_RX = syscall.PROT_READ | syscall.PROT_EXEC
_RW = syscall.PROT_READ | syscall.PROT_WRITE
)
type Loader []byte
type Function unsafe.Pointer
func (self Loader) Load(fn string, fp int, args int, argPtrs []bool, localPtrs []bool) (f Function) {
p := os.Getpagesize()
n := (((len(self) - 1) / p) + 1) * p
/* register the function */
m := mmap(n)
v := fmt.Sprintf("runtime.__%s_%x", fn, m)
registerFunction(v, m, uintptr(n), fp, args, uintptr(len(self)), argPtrs, localPtrs)
/* reference as a slice */
s := *(*[]byte)(unsafe.Pointer(&reflect.SliceHeader {
Data : m,
Cap : n,
Len : len(self),
}))
/* copy the machine code, and make it executable */
copy(s, self)
mprotect(m, n)
return Function(&m)
}
func mmap(nb int) uintptr {
if m, _, e := syscall.RawSyscall6(syscall.SYS_MMAP, 0, uintptr(nb), _RW, _AP, 0, 0); e != 0 {
panic(e)
} else {
return m
}
}
func mprotect(p uintptr, nb int) {
if _, _, err := syscall.RawSyscall(syscall.SYS_MPROTECT, p, uintptr(nb), _RX); err != 0 {
panic(err)
}
}

View File

@@ -1,111 +0,0 @@
//go:build windows
// +build windows
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`fmt`
`os`
`reflect`
`syscall`
`unsafe`
)
const (
MEM_COMMIT = 0x00001000
MEM_RESERVE = 0x00002000
)
var (
libKernel32 = syscall.NewLazyDLL("KERNEL32.DLL")
libKernel32_VirtualAlloc = libKernel32.NewProc("VirtualAlloc")
libKernel32_VirtualProtect = libKernel32.NewProc("VirtualProtect")
)
type Loader []byte
type Function unsafe.Pointer
func (self Loader) Load(fn string, fp int, args int, argPtrs []bool, localPtrs []bool) (f Function) {
p := os.Getpagesize()
n := (((len(self) - 1) / p) + 1) * p
/* register the function */
m := mmap(n)
v := fmt.Sprintf("runtime.__%s_%x", fn, m)
registerFunction(v, m, uintptr(n), fp, args, uintptr(len(self)), argPtrs, localPtrs)
/* reference as a slice */
s := *(*[]byte)(unsafe.Pointer(&reflect.SliceHeader {
Data : m,
Cap : n,
Len : len(self),
}))
/* copy the machine code, and make it executable */
copy(s, self)
mprotect(m, n)
return Function(&m)
}
func mmap(nb int) uintptr {
addr, err := winapi_VirtualAlloc(0, nb, MEM_COMMIT|MEM_RESERVE, syscall.PAGE_READWRITE)
if err != nil {
panic(err)
}
return addr
}
func mprotect(p uintptr, nb int) (oldProtect int) {
err := winapi_VirtualProtect(p, nb, syscall.PAGE_EXECUTE_READ, &oldProtect)
if err != nil {
panic(err)
}
return
}
// winapi_VirtualAlloc allocate memory
// Doc: https://docs.microsoft.com/en-us/windows/win32/api/memoryapi/nf-memoryapi-virtualalloc
func winapi_VirtualAlloc(lpAddr uintptr, dwSize int, flAllocationType int, flProtect int) (uintptr, error) {
r1, _, err := libKernel32_VirtualAlloc.Call(
lpAddr,
uintptr(dwSize),
uintptr(flAllocationType),
uintptr(flProtect),
)
if r1 == 0 {
return 0, err
}
return r1, nil
}
// winapi_VirtualProtect change memory protection
// Doc: https://docs.microsoft.com/en-us/windows/win32/api/memoryapi/nf-memoryapi-virtualprotect
func winapi_VirtualProtect(lpAddr uintptr, dwSize int, flNewProtect int, lpflOldProtect *int) error {
r1, _, err := libKernel32_VirtualProtect.Call(
lpAddr,
uintptr(dwSize),
uintptr(flNewProtect),
uintptr(unsafe.Pointer(lpflOldProtect)),
)
if r1 == 0 {
return err
}
return nil
}

View File

@@ -1,5 +1,7 @@
// Code generated by Makefile, DO NOT EDIT.
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -22,114 +24,168 @@ import (
`unsafe`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/internal/rt`
)
var (
__i64toa func(out unsafe.Pointer, val int64) (ret int)
__u64toa func(out unsafe.Pointer, val uint64) (ret int)
__f64toa func(out unsafe.Pointer, val float64) (ret int)
__f32toa func(out unsafe.Pointer, val float32) (ret int)
__lspace func(sp unsafe.Pointer, nb int, off int) (ret int)
__quote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer, flags uint64) (ret int)
__html_escape func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer) (ret int)
__unquote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep unsafe.Pointer, flags uint64) (ret int)
__value func(s unsafe.Pointer, n int, p int, v unsafe.Pointer, flags uint64) (ret int)
__vstring func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer, flags uint64)
__vnumber func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vunsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__skip_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_one_fast func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__skip_array func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_object func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_number func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__validate_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__get_by_path func(s unsafe.Pointer, p unsafe.Pointer, path unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8 func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8_fast func(s unsafe.Pointer) (ret int)
__fsm_exec func(m unsafe.Pointer, s unsafe.Pointer, p unsafe.Pointer, flags uint64) (ret int)
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __i64toa(out *byte, val int64) (ret int)
func i64toa(out *byte, val int64) (ret int) {
return __i64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __u64toa(out *byte, val uint64) (ret int)
func u64toa(out *byte, val uint64) (ret int) {
return __u64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f64toa(out *byte, val float64) (ret int)
func f64toa(out *byte, val float64) (ret int) {
return __f64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f32toa(out *byte, val float32) (ret int)
func f32toa(out *byte, val float32) (ret int) {
return __f32toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __lspace(sp unsafe.Pointer, nb int, off int) (ret int)
func lspace(sp unsafe.Pointer, nb int, off int) (ret int) {
return __lspace(rt.NoEscape(sp), nb, off)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int)
func quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int) {
return __quote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int)
func html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int) {
return __html_escape(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int)
func unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int) {
return __unquote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(ep)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int)
func value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int) {
return __value(rt.NoEscape(unsafe.Pointer(s)), n, p, rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vstring(s *string, p *int, v *types.JsonState, flags uint64)
func vstring(s *string, p *int, v *types.JsonState, flags uint64) {
__vstring(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vnumber(s *string, p *int, v *types.JsonState)
func vnumber(s *string, p *int, v *types.JsonState) {
__vnumber(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vsigned(s *string, p *int, v *types.JsonState)
func vsigned(s *string, p *int, v *types.JsonState) {
__vsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vunsigned(s *string, p *int, v *types.JsonState)
func vunsigned(s *string, p *int, v *types.JsonState) {
__vunsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one_fast(s *string, p *int) (ret int)
func skip_one_fast(s *string, p *int) (ret int) {
return __skip_one_fast(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_array(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_object(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_number(s *string, p *int) (ret int)
func skip_number(s *string, p *int) (ret int) {
return __skip_number(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_one(s *string, p *int, m *types.StateMachine) (ret int)
func validate_one(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int)
func get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int) {
return __get_by_path(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(path)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8(s *string, p *int, m *types.StateMachine) (ret int)
func validate_utf8(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_utf8(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8_fast(s *string) (ret int)
func validate_utf8_fast(s *string) (ret int) {
return __validate_utf8_fast(rt.NoEscape(unsafe.Pointer(s)))
}
//go:nosplit
func fsm_exec(m *types.StateMachine, s *string, p *int, flags uint64) (ret int) {
return __fsm_exec(rt.NoEscape(unsafe.Pointer(m)), rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), flags)
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,49 +0,0 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package avx
var (
S_f64toa = _subr__f64toa
S_f32toa = _subr__f32toa
S_i64toa = _subr__i64toa
S_u64toa = _subr__u64toa
S_lspace = _subr__lspace
)
var (
S_quote = _subr__quote
S_unquote = _subr__unquote
)
var (
S_value = _subr__value
S_vstring = _subr__vstring
S_vnumber = _subr__vnumber
S_vsigned = _subr__vsigned
S_vunsigned = _subr__vunsigned
)
var (
S_skip_one = _subr__skip_one
S_skip_one_fast = _subr__skip_one_fast
S_skip_array = _subr__skip_array
S_skip_object = _subr__skip_object
S_skip_number = _subr__skip_number
S_get_by_path = _subr__get_by_path
)

View File

@@ -3,107 +3,601 @@
package avx
//go:nosplit
//go:noescape
//goland:noinspection ALL
func __native_entry__() uintptr
import (
`github.com/bytedance/sonic/loader`
)
var (
_subr__f32toa = __native_entry__() + 31264
_subr__f64toa = __native_entry__() + 192
_subr__get_by_path = __native_entry__() + 25856
_subr__html_escape = __native_entry__() + 9040
_subr__i64toa = __native_entry__() + 3488
_subr__lspace = __native_entry__() + 16
_subr__quote = __native_entry__() + 4880
_subr__skip_array = __native_entry__() + 17952
_subr__skip_number = __native_entry__() + 21952
_subr__skip_object = __native_entry__() + 20368
_subr__skip_one = __native_entry__() + 22112
_subr__skip_one_fast = __native_entry__() + 22352
_subr__u64toa = __native_entry__() + 3600
_subr__unquote = __native_entry__() + 6672
_subr__validate_one = __native_entry__() + 22176
_subr__validate_utf8 = __native_entry__() + 30000
_subr__validate_utf8_fast = __native_entry__() + 30672
_subr__value = __native_entry__() + 12224
_subr__vnumber = __native_entry__() + 15616
_subr__vsigned = __native_entry__() + 17232
_subr__vstring = __native_entry__() + 14064
_subr__vunsigned = __native_entry__() + 17600
const (
_entry__f32toa = 31136
_entry__f64toa = 192
_entry__format_significand = 35248
_entry__format_integer = 3040
_entry__fsm_exec = 17920
_entry__advance_string = 14320
_entry__advance_string_default = 36640
_entry__do_skip_number = 20528
_entry__get_by_path = 25680
_entry__skip_one_fast = 22160
_entry__html_escape = 8912
_entry__i64toa = 3472
_entry__u64toa = 3584
_entry__lspace = 16
_entry__quote = 4864
_entry__skip_array = 17872
_entry__skip_number = 21792
_entry__skip_object = 20160
_entry__skip_one = 21936
_entry__unquote = 6576
_entry__validate_one = 21984
_entry__validate_utf8 = 29888
_entry__validate_utf8_fast = 30560
_entry__value = 12320
_entry__vnumber = 15648
_entry__atof_eisel_lemire64 = 10160
_entry__atof_native = 11712
_entry__decimal_to_f64 = 10528
_entry__right_shift = 36208
_entry__left_shift = 35712
_entry__vsigned = 17200
_entry__vstring = 14144
_entry__vunsigned = 17520
)
const (
_stack__f32toa = 48
_stack__f64toa = 80
_stack__get_by_path = 304
_stack__html_escape = 64
_stack__format_significand = 24
_stack__format_integer = 16
_stack__fsm_exec = 168
_stack__advance_string = 64
_stack__advance_string_default = 64
_stack__do_skip_number = 48
_stack__get_by_path = 280
_stack__skip_one_fast = 176
_stack__html_escape = 72
_stack__i64toa = 16
_stack__u64toa = 8
_stack__lspace = 8
_stack__quote = 56
_stack__skip_array = 128
_stack__skip_number = 72
_stack__skip_object = 128
_stack__skip_one = 128
_stack__skip_one_fast = 200
_stack__u64toa = 8
_stack__skip_array = 176
_stack__skip_number = 88
_stack__skip_object = 176
_stack__skip_one = 176
_stack__unquote = 88
_stack__validate_one = 128
_stack__validate_one = 176
_stack__validate_utf8 = 48
_stack__validate_utf8_fast = 24
_stack__value = 328
_stack__vnumber = 240
_stack__atof_eisel_lemire64 = 32
_stack__atof_native = 136
_stack__decimal_to_f64 = 80
_stack__right_shift = 8
_stack__left_shift = 24
_stack__vsigned = 16
_stack__vstring = 136
_stack__vunsigned = 16
)
var (
_ = _subr__f32toa
_ = _subr__f64toa
_ = _subr__get_by_path
_ = _subr__html_escape
_ = _subr__i64toa
_ = _subr__lspace
_ = _subr__quote
_ = _subr__skip_array
_ = _subr__skip_number
_ = _subr__skip_object
_ = _subr__skip_one
_ = _subr__skip_one_fast
_ = _subr__u64toa
_ = _subr__unquote
_ = _subr__validate_one
_ = _subr__validate_utf8
_ = _subr__validate_utf8_fast
_ = _subr__value
_ = _subr__vnumber
_ = _subr__vsigned
_ = _subr__vstring
_ = _subr__vunsigned
_stack__vstring = 120
_stack__vunsigned = 8
)
const (
_ = _stack__f32toa
_ = _stack__f64toa
_ = _stack__get_by_path
_ = _stack__html_escape
_ = _stack__i64toa
_ = _stack__lspace
_ = _stack__quote
_ = _stack__skip_array
_ = _stack__skip_number
_ = _stack__skip_object
_ = _stack__skip_one
_ = _stack__skip_one_fast
_ = _stack__u64toa
_ = _stack__unquote
_ = _stack__validate_one
_ = _stack__validate_utf8
_ = _stack__validate_utf8_fast
_ = _stack__value
_ = _stack__vnumber
_ = _stack__vsigned
_ = _stack__vstring
_ = _stack__vunsigned
_size__f32toa = 3392
_size__f64toa = 2848
_size__format_significand = 464
_size__format_integer = 432
_size__fsm_exec = 1692
_size__advance_string = 1280
_size__advance_string_default = 944
_size__do_skip_number = 924
_size__get_by_path = 4208
_size__skip_one_fast = 3016
_size__html_escape = 1248
_size__i64toa = 48
_size__u64toa = 1232
_size__lspace = 144
_size__quote = 1696
_size__skip_array = 48
_size__skip_number = 144
_size__skip_object = 48
_size__skip_one = 48
_size__unquote = 2272
_size__validate_one = 48
_size__validate_utf8 = 672
_size__validate_utf8_fast = 544
_size__value = 1316
_size__vnumber = 1552
_size__atof_eisel_lemire64 = 368
_size__atof_native = 608
_size__decimal_to_f64 = 1184
_size__right_shift = 400
_size__left_shift = 496
_size__vsigned = 320
_size__vstring = 128
_size__vunsigned = 336
)
var (
_pcsp__f32toa = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{3350, 48},
{3351, 40},
{3353, 32},
{3355, 24},
{3357, 16},
{3359, 8},
{3363, 0},
{3385, 48},
}
_pcsp__f64toa = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{2788, 56},
{2792, 48},
{2793, 40},
{2795, 32},
{2797, 24},
{2799, 16},
{2801, 8},
{2805, 0},
{2843, 56},
}
_pcsp__format_significand = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{452, 24},
{453, 16},
{455, 8},
{457, 0},
}
_pcsp__format_integer = [][2]uint32{
{1, 0},
{4, 8},
{412, 16},
{413, 8},
{414, 0},
{423, 16},
{424, 8},
{426, 0},
}
_pcsp__fsm_exec = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1342, 104},
{1346, 48},
{1347, 40},
{1349, 32},
{1351, 24},
{1353, 16},
{1355, 8},
{1356, 0},
{1692, 104},
}
_pcsp__advance_string = [][2]uint32{
{14, 0},
{18, 8},
{20, 16},
{22, 24},
{24, 32},
{26, 40},
{27, 48},
{557, 56},
{561, 48},
{562, 40},
{564, 32},
{566, 24},
{568, 16},
{570, 8},
{571, 0},
{1268, 56},
}
_pcsp__advance_string_default = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{552, 64},
{556, 48},
{557, 40},
{559, 32},
{561, 24},
{563, 16},
{565, 8},
{566, 0},
{931, 64},
}
_pcsp__do_skip_number = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{849, 48},
{850, 40},
{852, 32},
{854, 24},
{856, 16},
{858, 8},
{859, 0},
{924, 48},
}
_pcsp__get_by_path = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{4012, 104},
{4016, 48},
{4017, 40},
{4019, 32},
{4021, 24},
{4023, 16},
{4025, 8},
{4026, 0},
{4194, 104},
}
_pcsp__skip_one_fast = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{658, 176},
{659, 168},
{661, 160},
{663, 152},
{665, 144},
{667, 136},
{671, 128},
{3016, 176},
}
_pcsp__html_escape = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1224, 72},
{1228, 48},
{1229, 40},
{1231, 32},
{1233, 24},
{1235, 16},
{1237, 8},
{1239, 0},
}
_pcsp__i64toa = [][2]uint32{
{14, 0},
{34, 8},
{36, 0},
}
_pcsp__u64toa = [][2]uint32{
{1, 0},
{161, 8},
{162, 0},
{457, 8},
{458, 0},
{756, 8},
{757, 0},
{1221, 8},
{1223, 0},
}
_pcsp__lspace = [][2]uint32{
{1, 0},
{89, 8},
{90, 0},
{103, 8},
{104, 0},
{111, 8},
{113, 0},
}
_pcsp__quote = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1649, 56},
{1653, 48},
{1654, 40},
{1656, 32},
{1658, 24},
{1660, 16},
{1662, 8},
{1663, 0},
{1690, 56},
}
_pcsp__skip_array = [][2]uint32{
{1, 0},
{28, 8},
{34, 0},
}
_pcsp__skip_number = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{100, 40},
{101, 32},
{103, 24},
{105, 16},
{107, 8},
{108, 0},
{139, 40},
}
_pcsp__skip_object = [][2]uint32{
{1, 0},
{28, 8},
{34, 0},
}
_pcsp__skip_one = [][2]uint32{
{1, 0},
{30, 8},
{36, 0},
}
_pcsp__unquote = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1684, 88},
{1688, 48},
{1689, 40},
{1691, 32},
{1693, 24},
{1695, 16},
{1697, 8},
{1698, 0},
{2270, 88},
}
_pcsp__validate_one = [][2]uint32{
{1, 0},
{35, 8},
{41, 0},
}
_pcsp__validate_utf8 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{11, 40},
{623, 48},
{627, 40},
{628, 32},
{630, 24},
{632, 16},
{634, 8},
{635, 0},
{666, 48},
}
_pcsp__validate_utf8_fast = [][2]uint32{
{1, 0},
{4, 8},
{5, 16},
{247, 24},
{251, 16},
{252, 8},
{253, 0},
{527, 24},
{531, 16},
{532, 8},
{534, 0},
}
_pcsp__value = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{495, 88},
{499, 48},
{500, 40},
{502, 32},
{504, 24},
{506, 16},
{508, 8},
{509, 0},
{1316, 88},
}
_pcsp__vnumber = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{803, 104},
{807, 48},
{808, 40},
{810, 32},
{812, 24},
{814, 16},
{816, 8},
{817, 0},
{1547, 104},
}
_pcsp__atof_eisel_lemire64 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{292, 32},
{293, 24},
{295, 16},
{297, 8},
{298, 0},
{362, 32},
}
_pcsp__atof_native = [][2]uint32{
{1, 0},
{4, 8},
{587, 56},
{591, 8},
{593, 0},
}
_pcsp__decimal_to_f64 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1144, 56},
{1148, 48},
{1149, 40},
{1151, 32},
{1153, 24},
{1155, 16},
{1157, 8},
{1158, 0},
{1169, 56},
}
_pcsp__right_shift = [][2]uint32{
{1, 0},
{318, 8},
{319, 0},
{387, 8},
{388, 0},
{396, 8},
{398, 0},
}
_pcsp__left_shift = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{363, 24},
{364, 16},
{366, 8},
{367, 0},
{470, 24},
{471, 16},
{473, 8},
{474, 0},
{486, 24},
}
_pcsp__vsigned = [][2]uint32{
{1, 0},
{4, 8},
{112, 16},
{113, 8},
{114, 0},
{125, 16},
{126, 8},
{127, 0},
{260, 16},
{261, 8},
{262, 0},
{266, 16},
{267, 8},
{268, 0},
{306, 16},
{307, 8},
{308, 0},
{316, 16},
{317, 8},
{319, 0},
}
_pcsp__vstring = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{11, 40},
{105, 56},
{109, 40},
{110, 32},
{112, 24},
{114, 16},
{116, 8},
{118, 0},
}
_pcsp__vunsigned = [][2]uint32{
{1, 0},
{71, 8},
{72, 0},
{83, 8},
{84, 0},
{107, 8},
{108, 0},
{273, 8},
{274, 0},
{312, 8},
{313, 0},
{320, 8},
{322, 0},
}
)
var Funcs = []loader.CFunc{
{"__native_entry__", 0, 67, 0, nil},
{"_f32toa", _entry__f32toa, _size__f32toa, _stack__f32toa, _pcsp__f32toa},
{"_f64toa", _entry__f64toa, _size__f64toa, _stack__f64toa, _pcsp__f64toa},
{"_format_significand", _entry__format_significand, _size__format_significand, _stack__format_significand, _pcsp__format_significand},
{"_format_integer", _entry__format_integer, _size__format_integer, _stack__format_integer, _pcsp__format_integer},
{"_fsm_exec", _entry__fsm_exec, _size__fsm_exec, _stack__fsm_exec, _pcsp__fsm_exec},
{"_advance_string", _entry__advance_string, _size__advance_string, _stack__advance_string, _pcsp__advance_string},
{"_advance_string_default", _entry__advance_string_default, _size__advance_string_default, _stack__advance_string_default, _pcsp__advance_string_default},
{"_do_skip_number", _entry__do_skip_number, _size__do_skip_number, _stack__do_skip_number, _pcsp__do_skip_number},
{"_get_by_path", _entry__get_by_path, _size__get_by_path, _stack__get_by_path, _pcsp__get_by_path},
{"_skip_one_fast", _entry__skip_one_fast, _size__skip_one_fast, _stack__skip_one_fast, _pcsp__skip_one_fast},
{"_html_escape", _entry__html_escape, _size__html_escape, _stack__html_escape, _pcsp__html_escape},
{"_i64toa", _entry__i64toa, _size__i64toa, _stack__i64toa, _pcsp__i64toa},
{"_u64toa", _entry__u64toa, _size__u64toa, _stack__u64toa, _pcsp__u64toa},
{"_lspace", _entry__lspace, _size__lspace, _stack__lspace, _pcsp__lspace},
{"_quote", _entry__quote, _size__quote, _stack__quote, _pcsp__quote},
{"_skip_array", _entry__skip_array, _size__skip_array, _stack__skip_array, _pcsp__skip_array},
{"_skip_number", _entry__skip_number, _size__skip_number, _stack__skip_number, _pcsp__skip_number},
{"_skip_object", _entry__skip_object, _size__skip_object, _stack__skip_object, _pcsp__skip_object},
{"_skip_one", _entry__skip_one, _size__skip_one, _stack__skip_one, _pcsp__skip_one},
{"_unquote", _entry__unquote, _size__unquote, _stack__unquote, _pcsp__unquote},
{"_validate_one", _entry__validate_one, _size__validate_one, _stack__validate_one, _pcsp__validate_one},
{"_validate_utf8", _entry__validate_utf8, _size__validate_utf8, _stack__validate_utf8, _pcsp__validate_utf8},
{"_validate_utf8_fast", _entry__validate_utf8_fast, _size__validate_utf8_fast, _stack__validate_utf8_fast, _pcsp__validate_utf8_fast},
{"_value", _entry__value, _size__value, _stack__value, _pcsp__value},
{"_vnumber", _entry__vnumber, _size__vnumber, _stack__vnumber, _pcsp__vnumber},
{"_atof_eisel_lemire64", _entry__atof_eisel_lemire64, _size__atof_eisel_lemire64, _stack__atof_eisel_lemire64, _pcsp__atof_eisel_lemire64},
{"_atof_native", _entry__atof_native, _size__atof_native, _stack__atof_native, _pcsp__atof_native},
{"_decimal_to_f64", _entry__decimal_to_f64, _size__decimal_to_f64, _stack__decimal_to_f64, _pcsp__decimal_to_f64},
{"_right_shift", _entry__right_shift, _size__right_shift, _stack__right_shift, _pcsp__right_shift},
{"_left_shift", _entry__left_shift, _size__left_shift, _stack__left_shift, _pcsp__left_shift},
{"_vsigned", _entry__vsigned, _size__vsigned, _stack__vsigned, _pcsp__vsigned},
{"_vstring", _entry__vstring, _size__vstring, _stack__vstring, _pcsp__vstring},
{"_vunsigned", _entry__vunsigned, _size__vunsigned, _stack__vunsigned, _pcsp__vunsigned},
}

View File

@@ -1,5 +1,7 @@
// Code generated by Makefile, DO NOT EDIT.
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -22,114 +24,168 @@ import (
`unsafe`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/internal/rt`
)
var (
__i64toa func(out unsafe.Pointer, val int64) (ret int)
__u64toa func(out unsafe.Pointer, val uint64) (ret int)
__f64toa func(out unsafe.Pointer, val float64) (ret int)
__f32toa func(out unsafe.Pointer, val float32) (ret int)
__lspace func(sp unsafe.Pointer, nb int, off int) (ret int)
__quote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer, flags uint64) (ret int)
__html_escape func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer) (ret int)
__unquote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep unsafe.Pointer, flags uint64) (ret int)
__value func(s unsafe.Pointer, n int, p int, v unsafe.Pointer, flags uint64) (ret int)
__vstring func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer, flags uint64)
__vnumber func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vunsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__skip_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_one_fast func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__skip_array func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_object func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_number func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__validate_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__get_by_path func(s unsafe.Pointer, p unsafe.Pointer, path unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8 func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8_fast func(s unsafe.Pointer) (ret int)
__fsm_exec func(m unsafe.Pointer, s unsafe.Pointer, p unsafe.Pointer, flags uint64) (ret int)
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __i64toa(out *byte, val int64) (ret int)
func i64toa(out *byte, val int64) (ret int) {
return __i64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __u64toa(out *byte, val uint64) (ret int)
func u64toa(out *byte, val uint64) (ret int) {
return __u64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f64toa(out *byte, val float64) (ret int)
func f64toa(out *byte, val float64) (ret int) {
return __f64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f32toa(out *byte, val float32) (ret int)
func f32toa(out *byte, val float32) (ret int) {
return __f32toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __lspace(sp unsafe.Pointer, nb int, off int) (ret int)
func lspace(sp unsafe.Pointer, nb int, off int) (ret int) {
return __lspace(rt.NoEscape(sp), nb, off)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int)
func quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int) {
return __quote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int)
func html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int) {
return __html_escape(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int)
func unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int) {
return __unquote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(ep)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int)
func value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int) {
return __value(rt.NoEscape(unsafe.Pointer(s)), n, p, rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vstring(s *string, p *int, v *types.JsonState, flags uint64)
func vstring(s *string, p *int, v *types.JsonState, flags uint64) {
__vstring(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vnumber(s *string, p *int, v *types.JsonState)
func vnumber(s *string, p *int, v *types.JsonState) {
__vnumber(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vsigned(s *string, p *int, v *types.JsonState)
func vsigned(s *string, p *int, v *types.JsonState) {
__vsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vunsigned(s *string, p *int, v *types.JsonState)
func vunsigned(s *string, p *int, v *types.JsonState) {
__vunsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one_fast(s *string, p *int) (ret int)
func skip_one_fast(s *string, p *int) (ret int) {
return __skip_one_fast(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_array(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_object(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_number(s *string, p *int) (ret int)
func skip_number(s *string, p *int) (ret int) {
return __skip_number(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_one(s *string, p *int, m *types.StateMachine) (ret int)
func validate_one(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int)
func get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int) {
return __get_by_path(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(path)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8(s *string, p *int, m *types.StateMachine) (ret int)
func validate_utf8(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_utf8(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8_fast(s *string) (ret int)
func validate_utf8_fast(s *string) (ret int) {
return __validate_utf8_fast(rt.NoEscape(unsafe.Pointer(s)))
}
//go:nosplit
func fsm_exec(m *types.StateMachine, s *string, p *int, flags uint64) (ret int) {
return __fsm_exec(rt.NoEscape(unsafe.Pointer(m)), rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), flags)
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,49 +0,0 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package avx2
var (
S_f64toa = _subr__f64toa
S_f32toa = _subr__f32toa
S_i64toa = _subr__i64toa
S_u64toa = _subr__u64toa
S_lspace = _subr__lspace
)
var (
S_quote = _subr__quote
S_unquote = _subr__unquote
)
var (
S_value = _subr__value
S_vstring = _subr__vstring
S_vnumber = _subr__vnumber
S_vsigned = _subr__vsigned
S_vunsigned = _subr__vunsigned
)
var (
S_skip_one = _subr__skip_one
S_skip_one_fast = _subr__skip_one_fast
S_skip_array = _subr__skip_array
S_skip_object = _subr__skip_object
S_skip_number = _subr__skip_number
S_get_by_path = _subr__get_by_path
)

View File

@@ -3,107 +3,608 @@
package avx2
//go:nosplit
//go:noescape
//goland:noinspection ALL
func __native_entry__() uintptr
import (
`github.com/bytedance/sonic/loader`
)
var (
_subr__f32toa = __native_entry__() + 33888
_subr__f64toa = __native_entry__() + 288
_subr__get_by_path = __native_entry__() + 28336
_subr__html_escape = __native_entry__() + 10496
_subr__i64toa = __native_entry__() + 3584
_subr__lspace = __native_entry__() + 64
_subr__quote = __native_entry__() + 5072
_subr__skip_array = __native_entry__() + 20688
_subr__skip_number = __native_entry__() + 24912
_subr__skip_object = __native_entry__() + 22736
_subr__skip_one = __native_entry__() + 25072
_subr__skip_one_fast = __native_entry__() + 25488
_subr__u64toa = __native_entry__() + 3696
_subr__unquote = __native_entry__() + 7888
_subr__validate_one = __native_entry__() + 25136
_subr__validate_utf8 = __native_entry__() + 30320
_subr__validate_utf8_fast = __native_entry__() + 31280
_subr__value = __native_entry__() + 15024
_subr__vnumber = __native_entry__() + 18352
_subr__vsigned = __native_entry__() + 19968
_subr__vstring = __native_entry__() + 17024
_subr__vunsigned = __native_entry__() + 20336
const (
_entry__f32toa = 34624
_entry__f64toa = 320
_entry__format_significand = 38736
_entry__format_integer = 3168
_entry__fsm_exec = 21072
_entry__advance_ns = 16928
_entry__advance_string = 17664
_entry__advance_string_default = 40160
_entry__do_skip_number = 23696
_entry__get_by_path = 28864
_entry__skip_one_fast = 25936
_entry__html_escape = 10560
_entry__i64toa = 3600
_entry__u64toa = 3712
_entry__lspace = 64
_entry__quote = 5104
_entry__skip_array = 21024
_entry__skip_number = 25392
_entry__skip_object = 23088
_entry__skip_one = 25536
_entry__unquote = 7888
_entry__validate_one = 25584
_entry__validate_utf8 = 31040
_entry__validate_utf8_fast = 31984
_entry__value = 15376
_entry__vnumber = 18800
_entry__atof_eisel_lemire64 = 12624
_entry__atof_native = 14768
_entry__decimal_to_f64 = 13056
_entry__right_shift = 39696
_entry__left_shift = 39200
_entry__vsigned = 20352
_entry__vstring = 17424
_entry__vunsigned = 20672
)
const (
_stack__f32toa = 48
_stack__f64toa = 80
_stack__get_by_path = 296
_stack__format_significand = 24
_stack__format_integer = 16
_stack__fsm_exec = 144
_stack__advance_ns = 8
_stack__advance_string = 56
_stack__advance_string_default = 48
_stack__do_skip_number = 48
_stack__get_by_path = 272
_stack__skip_one_fast = 184
_stack__html_escape = 72
_stack__i64toa = 16
_stack__u64toa = 8
_stack__lspace = 8
_stack__quote = 56
_stack__skip_array = 128
_stack__skip_number = 72
_stack__skip_object = 128
_stack__skip_one = 128
_stack__skip_one_fast = 208
_stack__u64toa = 8
_stack__skip_array = 152
_stack__skip_number = 88
_stack__skip_object = 152
_stack__skip_one = 152
_stack__unquote = 72
_stack__validate_one = 128
_stack__validate_one = 152
_stack__validate_utf8 = 48
_stack__validate_utf8_fast = 176
_stack__value = 328
_stack__vnumber = 240
_stack__atof_eisel_lemire64 = 32
_stack__atof_native = 136
_stack__decimal_to_f64 = 80
_stack__right_shift = 8
_stack__left_shift = 24
_stack__vsigned = 16
_stack__vstring = 112
_stack__vunsigned = 16
)
var (
_ = _subr__f32toa
_ = _subr__f64toa
_ = _subr__get_by_path
_ = _subr__html_escape
_ = _subr__i64toa
_ = _subr__lspace
_ = _subr__quote
_ = _subr__skip_array
_ = _subr__skip_number
_ = _subr__skip_object
_ = _subr__skip_one
_ = _subr__skip_one_fast
_ = _subr__u64toa
_ = _subr__unquote
_ = _subr__validate_one
_ = _subr__validate_utf8
_ = _subr__validate_utf8_fast
_ = _subr__value
_ = _subr__vnumber
_ = _subr__vsigned
_ = _subr__vstring
_ = _subr__vunsigned
_stack__vunsigned = 8
)
const (
_ = _stack__f32toa
_ = _stack__f64toa
_ = _stack__get_by_path
_ = _stack__html_escape
_ = _stack__i64toa
_ = _stack__lspace
_ = _stack__quote
_ = _stack__skip_array
_ = _stack__skip_number
_ = _stack__skip_object
_ = _stack__skip_one
_ = _stack__skip_one_fast
_ = _stack__u64toa
_ = _stack__unquote
_ = _stack__validate_one
_ = _stack__validate_utf8
_ = _stack__validate_utf8_fast
_ = _stack__value
_ = _stack__vnumber
_ = _stack__vsigned
_ = _stack__vstring
_ = _stack__vunsigned
_size__f32toa = 3392
_size__f64toa = 2848
_size__format_significand = 464
_size__format_integer = 432
_size__fsm_exec = 1468
_size__advance_ns = 496
_size__advance_string = 1088
_size__advance_string_default = 768
_size__do_skip_number = 1360
_size__get_by_path = 2176
_size__skip_one_fast = 2428
_size__html_escape = 2064
_size__i64toa = 48
_size__u64toa = 1248
_size__lspace = 224
_size__quote = 2736
_size__skip_array = 48
_size__skip_number = 144
_size__skip_object = 48
_size__skip_one = 48
_size__unquote = 2480
_size__validate_one = 48
_size__validate_utf8 = 672
_size__validate_utf8_fast = 2608
_size__value = 1004
_size__vnumber = 1552
_size__atof_eisel_lemire64 = 368
_size__atof_native = 608
_size__decimal_to_f64 = 1712
_size__right_shift = 400
_size__left_shift = 496
_size__vsigned = 320
_size__vstring = 144
_size__vunsigned = 336
)
var (
_pcsp__f32toa = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{3350, 48},
{3351, 40},
{3353, 32},
{3355, 24},
{3357, 16},
{3359, 8},
{3363, 0},
{3385, 48},
}
_pcsp__f64toa = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{2788, 56},
{2792, 48},
{2793, 40},
{2795, 32},
{2797, 24},
{2799, 16},
{2801, 8},
{2805, 0},
{2843, 56},
}
_pcsp__format_significand = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{452, 24},
{453, 16},
{455, 8},
{457, 0},
}
_pcsp__format_integer = [][2]uint32{
{1, 0},
{4, 8},
{412, 16},
{413, 8},
{414, 0},
{423, 16},
{424, 8},
{426, 0},
}
_pcsp__fsm_exec = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1157, 88},
{1161, 48},
{1162, 40},
{1164, 32},
{1166, 24},
{1168, 16},
{1170, 8},
{1171, 0},
{1468, 88},
}
_pcsp__advance_ns = [][2]uint32{
{1, 0},
{453, 8},
{457, 0},
{481, 8},
{486, 0},
}
_pcsp__advance_string = [][2]uint32{
{14, 0},
{18, 8},
{20, 16},
{22, 24},
{24, 32},
{26, 40},
{27, 48},
{433, 56},
{437, 48},
{438, 40},
{440, 32},
{442, 24},
{444, 16},
{446, 8},
{450, 0},
{1078, 56},
}
_pcsp__advance_string_default = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{332, 48},
{333, 40},
{335, 32},
{337, 24},
{339, 16},
{341, 8},
{345, 0},
{757, 48},
}
_pcsp__do_skip_number = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{1274, 48},
{1275, 40},
{1277, 32},
{1279, 24},
{1281, 16},
{1283, 8},
{1287, 0},
{1360, 48},
}
_pcsp__get_by_path = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{2049, 88},
{2053, 48},
{2054, 40},
{2056, 32},
{2058, 24},
{2060, 16},
{2062, 8},
{2063, 0},
{2170, 88},
}
_pcsp__skip_one_fast = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{418, 176},
{419, 168},
{421, 160},
{423, 152},
{425, 144},
{427, 136},
{431, 128},
{2428, 176},
}
_pcsp__html_escape = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{2045, 72},
{2049, 48},
{2050, 40},
{2052, 32},
{2054, 24},
{2056, 16},
{2058, 8},
{2063, 0},
}
_pcsp__i64toa = [][2]uint32{
{14, 0},
{34, 8},
{36, 0},
}
_pcsp__u64toa = [][2]uint32{
{1, 0},
{161, 8},
{162, 0},
{457, 8},
{458, 0},
{758, 8},
{759, 0},
{1225, 8},
{1227, 0},
}
_pcsp__lspace = [][2]uint32{
{1, 0},
{184, 8},
{188, 0},
{204, 8},
{208, 0},
{215, 8},
{220, 0},
}
_pcsp__quote = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{2687, 56},
{2691, 48},
{2692, 40},
{2694, 32},
{2696, 24},
{2698, 16},
{2700, 8},
{2704, 0},
{2731, 56},
}
_pcsp__skip_array = [][2]uint32{
{1, 0},
{28, 8},
{34, 0},
}
_pcsp__skip_number = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{100, 40},
{101, 32},
{103, 24},
{105, 16},
{107, 8},
{108, 0},
{139, 40},
}
_pcsp__skip_object = [][2]uint32{
{1, 0},
{28, 8},
{34, 0},
}
_pcsp__skip_one = [][2]uint32{
{1, 0},
{30, 8},
{36, 0},
}
_pcsp__unquote = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{79, 72},
{83, 48},
{84, 40},
{86, 32},
{88, 24},
{90, 16},
{92, 8},
{96, 0},
{2464, 72},
}
_pcsp__validate_one = [][2]uint32{
{1, 0},
{35, 8},
{41, 0},
}
_pcsp__validate_utf8 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{11, 40},
{623, 48},
{627, 40},
{628, 32},
{630, 24},
{632, 16},
{634, 8},
{635, 0},
{666, 48},
}
_pcsp__validate_utf8_fast = [][2]uint32{
{1, 0},
{4, 8},
{5, 16},
{1738, 176},
{1739, 168},
{1743, 160},
{2018, 176},
{2019, 168},
{2023, 160},
{2600, 176},
}
_pcsp__value = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{988, 88},
{992, 48},
{993, 40},
{995, 32},
{997, 24},
{999, 16},
{1001, 8},
{1004, 0},
}
_pcsp__vnumber = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{803, 104},
{807, 48},
{808, 40},
{810, 32},
{812, 24},
{814, 16},
{816, 8},
{817, 0},
{1547, 104},
}
_pcsp__atof_eisel_lemire64 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{292, 32},
{293, 24},
{295, 16},
{297, 8},
{298, 0},
{362, 32},
}
_pcsp__atof_native = [][2]uint32{
{1, 0},
{4, 8},
{587, 56},
{591, 8},
{593, 0},
}
_pcsp__decimal_to_f64 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1673, 56},
{1677, 48},
{1678, 40},
{1680, 32},
{1682, 24},
{1684, 16},
{1686, 8},
{1690, 0},
{1702, 56},
}
_pcsp__right_shift = [][2]uint32{
{1, 0},
{318, 8},
{319, 0},
{387, 8},
{388, 0},
{396, 8},
{398, 0},
}
_pcsp__left_shift = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{363, 24},
{364, 16},
{366, 8},
{367, 0},
{470, 24},
{471, 16},
{473, 8},
{474, 0},
{486, 24},
}
_pcsp__vsigned = [][2]uint32{
{1, 0},
{4, 8},
{112, 16},
{113, 8},
{114, 0},
{125, 16},
{126, 8},
{127, 0},
{260, 16},
{261, 8},
{262, 0},
{266, 16},
{267, 8},
{268, 0},
{306, 16},
{307, 8},
{308, 0},
{316, 16},
{317, 8},
{319, 0},
}
_pcsp__vstring = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{11, 40},
{105, 56},
{109, 40},
{110, 32},
{112, 24},
{114, 16},
{116, 8},
{118, 0},
}
_pcsp__vunsigned = [][2]uint32{
{1, 0},
{71, 8},
{72, 0},
{83, 8},
{84, 0},
{107, 8},
{108, 0},
{273, 8},
{274, 0},
{312, 8},
{313, 0},
{320, 8},
{322, 0},
}
)
var Funcs = []loader.CFunc{
{"__native_entry__", 0, 67, 0, nil},
{"_f32toa", _entry__f32toa, _size__f32toa, _stack__f32toa, _pcsp__f32toa},
{"_f64toa", _entry__f64toa, _size__f64toa, _stack__f64toa, _pcsp__f64toa},
{"_format_significand", _entry__format_significand, _size__format_significand, _stack__format_significand, _pcsp__format_significand},
{"_format_integer", _entry__format_integer, _size__format_integer, _stack__format_integer, _pcsp__format_integer},
{"_fsm_exec", _entry__fsm_exec, _size__fsm_exec, _stack__fsm_exec, _pcsp__fsm_exec},
{"_advance_ns", _entry__advance_ns, _size__advance_ns, _stack__advance_ns, _pcsp__advance_ns},
{"_advance_string", _entry__advance_string, _size__advance_string, _stack__advance_string, _pcsp__advance_string},
{"_advance_string_default", _entry__advance_string_default, _size__advance_string_default, _stack__advance_string_default, _pcsp__advance_string_default},
{"_do_skip_number", _entry__do_skip_number, _size__do_skip_number, _stack__do_skip_number, _pcsp__do_skip_number},
{"_get_by_path", _entry__get_by_path, _size__get_by_path, _stack__get_by_path, _pcsp__get_by_path},
{"_skip_one_fast", _entry__skip_one_fast, _size__skip_one_fast, _stack__skip_one_fast, _pcsp__skip_one_fast},
{"_html_escape", _entry__html_escape, _size__html_escape, _stack__html_escape, _pcsp__html_escape},
{"_i64toa", _entry__i64toa, _size__i64toa, _stack__i64toa, _pcsp__i64toa},
{"_u64toa", _entry__u64toa, _size__u64toa, _stack__u64toa, _pcsp__u64toa},
{"_lspace", _entry__lspace, _size__lspace, _stack__lspace, _pcsp__lspace},
{"_quote", _entry__quote, _size__quote, _stack__quote, _pcsp__quote},
{"_skip_array", _entry__skip_array, _size__skip_array, _stack__skip_array, _pcsp__skip_array},
{"_skip_number", _entry__skip_number, _size__skip_number, _stack__skip_number, _pcsp__skip_number},
{"_skip_object", _entry__skip_object, _size__skip_object, _stack__skip_object, _pcsp__skip_object},
{"_skip_one", _entry__skip_one, _size__skip_one, _stack__skip_one, _pcsp__skip_one},
{"_unquote", _entry__unquote, _size__unquote, _stack__unquote, _pcsp__unquote},
{"_validate_one", _entry__validate_one, _size__validate_one, _stack__validate_one, _pcsp__validate_one},
{"_validate_utf8", _entry__validate_utf8, _size__validate_utf8, _stack__validate_utf8, _pcsp__validate_utf8},
{"_validate_utf8_fast", _entry__validate_utf8_fast, _size__validate_utf8_fast, _stack__validate_utf8_fast, _pcsp__validate_utf8_fast},
{"_value", _entry__value, _size__value, _stack__value, _pcsp__value},
{"_vnumber", _entry__vnumber, _size__vnumber, _stack__vnumber, _pcsp__vnumber},
{"_atof_eisel_lemire64", _entry__atof_eisel_lemire64, _size__atof_eisel_lemire64, _stack__atof_eisel_lemire64, _pcsp__atof_eisel_lemire64},
{"_atof_native", _entry__atof_native, _size__atof_native, _stack__atof_native, _pcsp__atof_native},
{"_decimal_to_f64", _entry__decimal_to_f64, _size__decimal_to_f64, _stack__decimal_to_f64, _pcsp__decimal_to_f64},
{"_right_shift", _entry__right_shift, _size__right_shift, _stack__right_shift, _pcsp__right_shift},
{"_left_shift", _entry__left_shift, _size__left_shift, _stack__left_shift, _pcsp__left_shift},
{"_vsigned", _entry__vsigned, _size__vsigned, _stack__vsigned, _pcsp__vsigned},
{"_vstring", _entry__vstring, _size__vstring, _stack__vstring, _pcsp__vstring},
{"_vunsigned", _entry__vunsigned, _size__vunsigned, _stack__vunsigned, _pcsp__vunsigned},
}

View File

@@ -24,6 +24,8 @@ import (
`github.com/bytedance/sonic/internal/native/avx2`
`github.com/bytedance/sonic/internal/native/sse`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/internal/rt`
`github.com/bytedance/sonic/loader`
)
const (
@@ -42,6 +44,7 @@ var (
var (
S_quote uintptr
S_unquote uintptr
S_html_escape uintptr
)
var (
@@ -61,132 +64,140 @@ var (
S_skip_number uintptr
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func Quote(s unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) int
var (
S_validate_one uintptr
S_validate_utf8 uintptr
S_validate_utf8_fast uintptr
)
var (
__Quote func(s unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer, flags uint64) int
__Unquote func(s unsafe.Pointer, nb int, dp unsafe.Pointer, ep unsafe.Pointer, flags uint64) int
__HTMLEscape func(s unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer) int
__Value func(s unsafe.Pointer, n int, p int, v unsafe.Pointer, flags uint64) int
__SkipOne func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) int
__SkipOneFast func(s unsafe.Pointer, p unsafe.Pointer) int
__GetByPath func(s unsafe.Pointer, p unsafe.Pointer, path unsafe.Pointer, m unsafe.Pointer) int
__ValidateOne func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) int
__I64toa func(out unsafe.Pointer, val int64) (ret int)
__U64toa func(out unsafe.Pointer, val uint64) (ret int)
__F64toa func(out unsafe.Pointer, val float64) (ret int)
__ValidateUTF8 func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__ValidateUTF8Fast func(s unsafe.Pointer) (ret int)
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func Unquote(s unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) int
func Quote(s unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) int {
return __Quote(rt.NoEscape(unsafe.Pointer(s)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func HTMLEscape(s unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) int
func Unquote(s unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) int {
return __Unquote(rt.NoEscape(unsafe.Pointer(s)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(ep)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func Value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) int
func HTMLEscape(s unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) int {
return __HTMLEscape(rt.NoEscape(unsafe.Pointer(s)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func SkipOne(s *string, p *int, m *types.StateMachine, flags uint64) int
func Value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) int {
return __Value(rt.NoEscape(unsafe.Pointer(s)), n, p, rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func SkipOneFast(s *string, p *int) int
func SkipOne(s *string, p *int, m *types.StateMachine, flags uint64) int {
return __SkipOne(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func GetByPath(s *string, p *int, path *[]interface{}, m *types.StateMachine) int
func SkipOneFast(s *string, p *int) int {
return __SkipOneFast(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func ValidateOne(s *string, p *int, m *types.StateMachine) int
func GetByPath(s *string, p *int, path *[]interface{}, m *types.StateMachine) int {
return __GetByPath(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(path)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func I64toa(out *byte, val int64) (ret int)
func ValidateOne(s *string, p *int, m *types.StateMachine) int {
return __ValidateOne(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func U64toa(out *byte, val uint64) (ret int)
func I64toa(out *byte, val int64) (ret int) {
return __I64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func F64toa(out *byte, val float64) (ret int)
func U64toa(out *byte, val uint64) (ret int) {
return __U64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func ValidateUTF8(s *string, p *int, m *types.StateMachine) (ret int)
func F64toa(out *byte, val float64) (ret int) {
return __F64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func ValidateUTF8Fast(s *string) (ret int)
func ValidateUTF8(s *string, p *int, m *types.StateMachine) (ret int) {
return __ValidateUTF8(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
func ValidateUTF8Fast(s *string) (ret int) {
return __ValidateUTF8Fast(rt.NoEscape(unsafe.Pointer(s)))
}
var stubs = []loader.GoC{
{"_f64toa", &S_f64toa, &__F64toa},
{"_f32toa", &S_f32toa, nil},
{"_i64toa", &S_i64toa, &__I64toa},
{"_u64toa", &S_u64toa, &__U64toa},
{"_lspace", &S_lspace, nil},
{"_quote", &S_quote, &__Quote},
{"_unquote", &S_unquote, &__Unquote},
{"_html_escape", &S_html_escape, &__HTMLEscape},
{"_value", &S_value, &__Value},
{"_vstring", &S_vstring, nil},
{"_vnumber", &S_vnumber, nil},
{"_vsigned", &S_vsigned, nil},
{"_vunsigned", &S_vunsigned, nil},
{"_skip_one", &S_skip_one, &__SkipOne},
{"_skip_one_fast", &S_skip_one_fast, &__SkipOneFast},
{"_get_by_path", &S_get_by_path, &__GetByPath},
{"_skip_array", &S_skip_array, nil},
{"_skip_object", &S_skip_object, nil},
{"_skip_number", &S_skip_number, nil},
{"_validate_one", &S_validate_one, &__ValidateOne},
{"_validate_utf8", &S_validate_utf8, &__ValidateUTF8},
{"_validate_utf8_fast", &S_validate_utf8_fast, &__ValidateUTF8Fast},
}
func useAVX() {
S_f64toa = avx.S_f64toa
S_f32toa = avx.S_f32toa
S_i64toa = avx.S_i64toa
S_u64toa = avx.S_u64toa
S_lspace = avx.S_lspace
S_quote = avx.S_quote
S_unquote = avx.S_unquote
S_value = avx.S_value
S_vstring = avx.S_vstring
S_vnumber = avx.S_vnumber
S_vsigned = avx.S_vsigned
S_vunsigned = avx.S_vunsigned
S_skip_one = avx.S_skip_one
S_skip_one_fast = avx.S_skip_one_fast
S_skip_array = avx.S_skip_array
S_skip_object = avx.S_skip_object
S_skip_number = avx.S_skip_number
S_get_by_path = avx.S_get_by_path
loader.WrapGoC(avx.Text__native_entry__, avx.Funcs, stubs, "avx", "avx/native.c")
}
func useAVX2() {
S_f64toa = avx2.S_f64toa
S_f32toa = avx2.S_f32toa
S_i64toa = avx2.S_i64toa
S_u64toa = avx2.S_u64toa
S_lspace = avx2.S_lspace
S_quote = avx2.S_quote
S_unquote = avx2.S_unquote
S_value = avx2.S_value
S_vstring = avx2.S_vstring
S_vnumber = avx2.S_vnumber
S_vsigned = avx2.S_vsigned
S_vunsigned = avx2.S_vunsigned
S_skip_one = avx2.S_skip_one
S_skip_one_fast = avx2.S_skip_one_fast
S_skip_array = avx2.S_skip_array
S_skip_object = avx2.S_skip_object
S_skip_number = avx2.S_skip_number
S_get_by_path = avx2.S_get_by_path
loader.WrapGoC(avx2.Text__native_entry__, avx2.Funcs, stubs, "avx2", "avx2/native.c")
}
func useSSE() {
S_f64toa = sse.S_f64toa
S_f32toa = sse.S_f32toa
S_i64toa = sse.S_i64toa
S_u64toa = sse.S_u64toa
S_lspace = sse.S_lspace
S_quote = sse.S_quote
S_unquote = sse.S_unquote
S_value = sse.S_value
S_vstring = sse.S_vstring
S_vnumber = sse.S_vnumber
S_vsigned = sse.S_vsigned
S_vunsigned = sse.S_vunsigned
S_skip_one = sse.S_skip_one
S_skip_one_fast = sse.S_skip_one_fast
S_skip_array = sse.S_skip_array
S_skip_object = sse.S_skip_object
S_skip_number = sse.S_skip_number
S_get_by_path = sse.S_get_by_path
loader.WrapGoC(sse.Text__native_entry__, sse.Funcs, stubs, "sse", "sse/native.c")
}
func init() {

View File

@@ -1,137 +0,0 @@
//
// Copyright 2021 ByteDance Inc.
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
// You may obtain a copy of the License at
//
// http://www.apache.org/licenses/LICENSE-2.0
//
// Unless required by applicable law or agreed to in writing, software
// distributed under the License is distributed on an "AS IS" BASIS,
// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
// See the License for the specific language governing permissions and
// limitations under the License.
//
#include "go_asm.h"
#include "funcdata.h"
#include "textflag.h"
TEXT ·Quote(SB), NOSPLIT, $0 - 48
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__quote(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__quote(SB)
JMP github·combytedancesonicinternalnativesse·__quote(SB)
TEXT ·Unquote(SB), NOSPLIT, $0 - 48
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__unquote(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__unquote(SB)
JMP github·combytedancesonicinternalnativesse·__unquote(SB)
TEXT ·HTMLEscape(SB), NOSPLIT, $0 - 40
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__html_escape(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__html_escape(SB)
JMP github·combytedancesonicinternalnativesse·__html_escape(SB)
TEXT ·Value(SB), NOSPLIT, $0 - 48
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__value(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__value(SB)
JMP github·combytedancesonicinternalnativesse·__value(SB)
TEXT ·SkipOne(SB), NOSPLIT, $0 - 40
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__skip_one(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__skip_one(SB)
JMP github·combytedancesonicinternalnativesse·__skip_one(SB)
TEXT ·SkipOneFast(SB), NOSPLIT, $0 - 24
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__skip_one_fast(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__skip_one_fast(SB)
JMP github·combytedancesonicinternalnativesse·__skip_one_fast(SB)
TEXT ·GetByPath(SB), NOSPLIT, $0 - 40
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__get_by_path(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__get_by_path(SB)
JMP github·combytedancesonicinternalnativesse·__get_by_path(SB)
TEXT ·ValidateOne(SB), NOSPLIT, $0 - 32
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__validate_one(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__validate_one(SB)
JMP github·combytedancesonicinternalnativesse·__validate_one(SB)
TEXT ·ValidateUTF8(SB), NOSPLIT, $0 - 40
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__validate_utf8(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__validate_utf8(SB)
JMP github·combytedancesonicinternalnativesse·__validate_utf8(SB)
TEXT ·ValidateUTF8Fast(SB), NOSPLIT, $0 - 16
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__validate_utf8_fast(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__validate_utf8_fast(SB)
JMP github·combytedancesonicinternalnativesse·__validate_utf8_fast(SB)
TEXT ·I64toa(SB), NOSPLIT, $0 - 32
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__i64toa(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__i64toa(SB)
JMP github·combytedancesonicinternalnativesse·__i64toa(SB)
TEXT ·U64toa(SB), NOSPLIT, $0 - 32
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__u64toa(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__u64toa(SB)
JMP github·combytedancesonicinternalnativesse·__u64toa(SB)
TEXT ·F64toa(SB), NOSPLIT, $0 - 32
CMPB github·combytedancesonicinternalcpu·HasAVX2(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx2·__f64toa(SB)
CMPB github·combytedancesonicinternalcpu·HasAVX(SB), $0
JE 2(PC)
JMP github·combytedancesonicinternalnativeavx·__f64toa(SB)
JMP github·combytedancesonicinternalnativesse·__f64toa(SB)

View File

@@ -1,3 +1,5 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -17,35 +19,35 @@
package {{PACKAGE}}
import (
`encoding/json`
`math`
`math/rand`
`strconv`
`testing`
`math/rand`
`encoding/json`
`github.com/stretchr/testify/assert`
)
func TestFastFloat_Encode(t *testing.T) {
var buf [64]byte
assert.Equal(t, "0" , string(buf[:__f64toa(&buf[0], 0)]))
assert.Equal(t, "-0" , string(buf[:__f64toa(&buf[0], math.Float64frombits(0x8000000000000000))]))
assert.Equal(t, "12340000000" , string(buf[:__f64toa(&buf[0], 1234e7)]))
assert.Equal(t, "12.34" , string(buf[:__f64toa(&buf[0], 1234e-2)]))
assert.Equal(t, "0.001234" , string(buf[:__f64toa(&buf[0], 1234e-6)]))
assert.Equal(t, "1e+30" , string(buf[:__f64toa(&buf[0], 1e30)]))
assert.Equal(t, "1.234e+33" , string(buf[:__f64toa(&buf[0], 1234e30)]))
assert.Equal(t, "1.234e+308" , string(buf[:__f64toa(&buf[0], 1234e305)]))
assert.Equal(t, "1.234e-317" , string(buf[:__f64toa(&buf[0], 1234e-320)]))
assert.Equal(t, "1.7976931348623157e+308" , string(buf[:__f64toa(&buf[0], 1.7976931348623157e308)]))
assert.Equal(t, "-12340000000" , string(buf[:__f64toa(&buf[0], -1234e7)]))
assert.Equal(t, "-12.34" , string(buf[:__f64toa(&buf[0], -1234e-2)]))
assert.Equal(t, "-0.001234" , string(buf[:__f64toa(&buf[0], -1234e-6)]))
assert.Equal(t, "-1e+30" , string(buf[:__f64toa(&buf[0], -1e30)]))
assert.Equal(t, "-1.234e+33" , string(buf[:__f64toa(&buf[0], -1234e30)]))
assert.Equal(t, "-1.234e+308" , string(buf[:__f64toa(&buf[0], -1234e305)]))
assert.Equal(t, "-1.234e-317" , string(buf[:__f64toa(&buf[0], -1234e-320)]))
assert.Equal(t, "-2.2250738585072014e-308" , string(buf[:__f64toa(&buf[0], -2.2250738585072014e-308)]))
assert.Equal(t, "0" , string(buf[:f64toa(&buf[0], 0)]))
assert.Equal(t, "-0" , string(buf[:f64toa(&buf[0], math.Float64frombits(0x8000000000000000))]))
assert.Equal(t, "12340000000" , string(buf[:f64toa(&buf[0], 1234e7)]))
assert.Equal(t, "12.34" , string(buf[:f64toa(&buf[0], 1234e-2)]))
assert.Equal(t, "0.001234" , string(buf[:f64toa(&buf[0], 1234e-6)]))
assert.Equal(t, "1e+30" , string(buf[:f64toa(&buf[0], 1e30)]))
assert.Equal(t, "1.234e+33" , string(buf[:f64toa(&buf[0], 1234e30)]))
assert.Equal(t, "1.234e+308" , string(buf[:f64toa(&buf[0], 1234e305)]))
assert.Equal(t, "1.234e-317" , string(buf[:f64toa(&buf[0], 1234e-320)]))
assert.Equal(t, "1.7976931348623157e+308" , string(buf[:f64toa(&buf[0], 1.7976931348623157e308)]))
assert.Equal(t, "-12340000000" , string(buf[:f64toa(&buf[0], -1234e7)]))
assert.Equal(t, "-12.34" , string(buf[:f64toa(&buf[0], -1234e-2)]))
assert.Equal(t, "-0.001234" , string(buf[:f64toa(&buf[0], -1234e-6)]))
assert.Equal(t, "-1e+30" , string(buf[:f64toa(&buf[0], -1e30)]))
assert.Equal(t, "-1.234e+33" , string(buf[:f64toa(&buf[0], -1234e30)]))
assert.Equal(t, "-1.234e+308" , string(buf[:f64toa(&buf[0], -1234e305)]))
assert.Equal(t, "-1.234e-317" , string(buf[:f64toa(&buf[0], -1234e-320)]))
assert.Equal(t, "-2.2250738585072014e-308" , string(buf[:f64toa(&buf[0], -2.2250738585072014e-308)]))
}
func TestFastFloat_Random(t *testing.T) {
@@ -56,7 +58,7 @@ func TestFastFloat_Random(t *testing.T) {
f64 := math.Float64frombits(b64)
jout, jerr := json.Marshal(f64)
n := __f64toa(&buf[0], f64)
n := f64toa(&buf[0], f64)
if jerr == nil {
assert.Equal(t, jout, buf[:n])
} else {
@@ -65,7 +67,7 @@ func TestFastFloat_Random(t *testing.T) {
f32 := math.Float32frombits(rand.Uint32())
jout, jerr = json.Marshal(f32)
n = __f32toa(&buf[0], f32)
n = f32toa(&buf[0], f32)
if jerr == nil {
assert.Equal(t, jout, buf[:n])
} else {
@@ -97,7 +99,7 @@ func BenchmarkParseFloat64(b *testing.B) {
test: func(b *testing.B) { var buf [64]byte; for i := 0; i < b.N; i++ { strconv.AppendFloat(buf[:0], c.float, 'g', -1, 64) }},
}, {
name: "FastFloat",
test: func(b *testing.B) { var buf [64]byte; for i := 0; i < b.N; i++ { __f64toa(&buf[0], c.float) }},
test: func(b *testing.B) { var buf [64]byte; for i := 0; i < b.N; i++ { f64toa(&buf[0], c.float) }},
}}
for _, bm := range f64bench {
name := bm.name + "_" + c.name
@@ -128,7 +130,7 @@ func BenchmarkParseFloat32(b *testing.B) {
test: func(b *testing.B) { var buf [64]byte; for i := 0; i < b.N; i++ { strconv.AppendFloat(buf[:0], float64(c.float), 'g', -1, 32) }},
}, {
name: "FastFloat32",
test: func(b *testing.B) { var buf [64]byte; for i := 0; i < b.N; i++ { __f32toa(&buf[0], c.float) }},
test: func(b *testing.B) { var buf [64]byte; for i := 0; i < b.N; i++ { f32toa(&buf[0], c.float) }},
}}
for _, bm := range bench {
name := bm.name + "_" + c.name

View File

@@ -1,3 +1,5 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -26,76 +28,76 @@ import (
func TestFastInt_IntToString(t *testing.T) {
var buf [32]byte
assert.Equal(t, "0" , string(buf[:__i64toa(&buf[0], 0)]))
assert.Equal(t, "1" , string(buf[:__i64toa(&buf[0], 1)]))
assert.Equal(t, "12" , string(buf[:__i64toa(&buf[0], 12)]))
assert.Equal(t, "123" , string(buf[:__i64toa(&buf[0], 123)]))
assert.Equal(t, "1234" , string(buf[:__i64toa(&buf[0], 1234)]))
assert.Equal(t, "12345" , string(buf[:__i64toa(&buf[0], 12345)]))
assert.Equal(t, "123456" , string(buf[:__i64toa(&buf[0], 123456)]))
assert.Equal(t, "1234567" , string(buf[:__i64toa(&buf[0], 1234567)]))
assert.Equal(t, "12345678" , string(buf[:__i64toa(&buf[0], 12345678)]))
assert.Equal(t, "123456789" , string(buf[:__i64toa(&buf[0], 123456789)]))
assert.Equal(t, "1234567890" , string(buf[:__i64toa(&buf[0], 1234567890)]))
assert.Equal(t, "12345678901" , string(buf[:__i64toa(&buf[0], 12345678901)]))
assert.Equal(t, "123456789012" , string(buf[:__i64toa(&buf[0], 123456789012)]))
assert.Equal(t, "1234567890123" , string(buf[:__i64toa(&buf[0], 1234567890123)]))
assert.Equal(t, "12345678901234" , string(buf[:__i64toa(&buf[0], 12345678901234)]))
assert.Equal(t, "123456789012345" , string(buf[:__i64toa(&buf[0], 123456789012345)]))
assert.Equal(t, "1234567890123456" , string(buf[:__i64toa(&buf[0], 1234567890123456)]))
assert.Equal(t, "12345678901234567" , string(buf[:__i64toa(&buf[0], 12345678901234567)]))
assert.Equal(t, "123456789012345678" , string(buf[:__i64toa(&buf[0], 123456789012345678)]))
assert.Equal(t, "1234567890123456789" , string(buf[:__i64toa(&buf[0], 1234567890123456789)]))
assert.Equal(t, "9223372036854775807" , string(buf[:__i64toa(&buf[0], 9223372036854775807)]))
assert.Equal(t, "-1" , string(buf[:__i64toa(&buf[0], -1)]))
assert.Equal(t, "-12" , string(buf[:__i64toa(&buf[0], -12)]))
assert.Equal(t, "-123" , string(buf[:__i64toa(&buf[0], -123)]))
assert.Equal(t, "-1234" , string(buf[:__i64toa(&buf[0], -1234)]))
assert.Equal(t, "-12345" , string(buf[:__i64toa(&buf[0], -12345)]))
assert.Equal(t, "-123456" , string(buf[:__i64toa(&buf[0], -123456)]))
assert.Equal(t, "-1234567" , string(buf[:__i64toa(&buf[0], -1234567)]))
assert.Equal(t, "-12345678" , string(buf[:__i64toa(&buf[0], -12345678)]))
assert.Equal(t, "-123456789" , string(buf[:__i64toa(&buf[0], -123456789)]))
assert.Equal(t, "-1234567890" , string(buf[:__i64toa(&buf[0], -1234567890)]))
assert.Equal(t, "-12345678901" , string(buf[:__i64toa(&buf[0], -12345678901)]))
assert.Equal(t, "-123456789012" , string(buf[:__i64toa(&buf[0], -123456789012)]))
assert.Equal(t, "-1234567890123" , string(buf[:__i64toa(&buf[0], -1234567890123)]))
assert.Equal(t, "-12345678901234" , string(buf[:__i64toa(&buf[0], -12345678901234)]))
assert.Equal(t, "-123456789012345" , string(buf[:__i64toa(&buf[0], -123456789012345)]))
assert.Equal(t, "-1234567890123456" , string(buf[:__i64toa(&buf[0], -1234567890123456)]))
assert.Equal(t, "-12345678901234567" , string(buf[:__i64toa(&buf[0], -12345678901234567)]))
assert.Equal(t, "-123456789012345678" , string(buf[:__i64toa(&buf[0], -123456789012345678)]))
assert.Equal(t, "-1234567890123456789" , string(buf[:__i64toa(&buf[0], -1234567890123456789)]))
assert.Equal(t, "-9223372036854775808" , string(buf[:__i64toa(&buf[0], -9223372036854775808)]))
assert.Equal(t, "0" , string(buf[:i64toa(&buf[0], 0)]))
assert.Equal(t, "1" , string(buf[:i64toa(&buf[0], 1)]))
assert.Equal(t, "12" , string(buf[:i64toa(&buf[0], 12)]))
assert.Equal(t, "123" , string(buf[:i64toa(&buf[0], 123)]))
assert.Equal(t, "1234" , string(buf[:i64toa(&buf[0], 1234)]))
assert.Equal(t, "12345" , string(buf[:i64toa(&buf[0], 12345)]))
assert.Equal(t, "123456" , string(buf[:i64toa(&buf[0], 123456)]))
assert.Equal(t, "1234567" , string(buf[:i64toa(&buf[0], 1234567)]))
assert.Equal(t, "12345678" , string(buf[:i64toa(&buf[0], 12345678)]))
assert.Equal(t, "123456789" , string(buf[:i64toa(&buf[0], 123456789)]))
assert.Equal(t, "1234567890" , string(buf[:i64toa(&buf[0], 1234567890)]))
assert.Equal(t, "12345678901" , string(buf[:i64toa(&buf[0], 12345678901)]))
assert.Equal(t, "123456789012" , string(buf[:i64toa(&buf[0], 123456789012)]))
assert.Equal(t, "1234567890123" , string(buf[:i64toa(&buf[0], 1234567890123)]))
assert.Equal(t, "12345678901234" , string(buf[:i64toa(&buf[0], 12345678901234)]))
assert.Equal(t, "123456789012345" , string(buf[:i64toa(&buf[0], 123456789012345)]))
assert.Equal(t, "1234567890123456" , string(buf[:i64toa(&buf[0], 1234567890123456)]))
assert.Equal(t, "12345678901234567" , string(buf[:i64toa(&buf[0], 12345678901234567)]))
assert.Equal(t, "123456789012345678" , string(buf[:i64toa(&buf[0], 123456789012345678)]))
assert.Equal(t, "1234567890123456789" , string(buf[:i64toa(&buf[0], 1234567890123456789)]))
assert.Equal(t, "9223372036854775807" , string(buf[:i64toa(&buf[0], 9223372036854775807)]))
assert.Equal(t, "-1" , string(buf[:i64toa(&buf[0], -1)]))
assert.Equal(t, "-12" , string(buf[:i64toa(&buf[0], -12)]))
assert.Equal(t, "-123" , string(buf[:i64toa(&buf[0], -123)]))
assert.Equal(t, "-1234" , string(buf[:i64toa(&buf[0], -1234)]))
assert.Equal(t, "-12345" , string(buf[:i64toa(&buf[0], -12345)]))
assert.Equal(t, "-123456" , string(buf[:i64toa(&buf[0], -123456)]))
assert.Equal(t, "-1234567" , string(buf[:i64toa(&buf[0], -1234567)]))
assert.Equal(t, "-12345678" , string(buf[:i64toa(&buf[0], -12345678)]))
assert.Equal(t, "-123456789" , string(buf[:i64toa(&buf[0], -123456789)]))
assert.Equal(t, "-1234567890" , string(buf[:i64toa(&buf[0], -1234567890)]))
assert.Equal(t, "-12345678901" , string(buf[:i64toa(&buf[0], -12345678901)]))
assert.Equal(t, "-123456789012" , string(buf[:i64toa(&buf[0], -123456789012)]))
assert.Equal(t, "-1234567890123" , string(buf[:i64toa(&buf[0], -1234567890123)]))
assert.Equal(t, "-12345678901234" , string(buf[:i64toa(&buf[0], -12345678901234)]))
assert.Equal(t, "-123456789012345" , string(buf[:i64toa(&buf[0], -123456789012345)]))
assert.Equal(t, "-1234567890123456" , string(buf[:i64toa(&buf[0], -1234567890123456)]))
assert.Equal(t, "-12345678901234567" , string(buf[:i64toa(&buf[0], -12345678901234567)]))
assert.Equal(t, "-123456789012345678" , string(buf[:i64toa(&buf[0], -123456789012345678)]))
assert.Equal(t, "-1234567890123456789" , string(buf[:i64toa(&buf[0], -1234567890123456789)]))
assert.Equal(t, "-9223372036854775808" , string(buf[:i64toa(&buf[0], -9223372036854775808)]))
}
func TestFastInt_UintToString(t *testing.T) {
var buf [32]byte
assert.Equal(t, "0" , string(buf[:__u64toa(&buf[0], 0)]))
assert.Equal(t, "1" , string(buf[:__u64toa(&buf[0], 1)]))
assert.Equal(t, "12" , string(buf[:__u64toa(&buf[0], 12)]))
assert.Equal(t, "123" , string(buf[:__u64toa(&buf[0], 123)]))
assert.Equal(t, "1234" , string(buf[:__u64toa(&buf[0], 1234)]))
assert.Equal(t, "12345" , string(buf[:__u64toa(&buf[0], 12345)]))
assert.Equal(t, "123456" , string(buf[:__u64toa(&buf[0], 123456)]))
assert.Equal(t, "1234567" , string(buf[:__u64toa(&buf[0], 1234567)]))
assert.Equal(t, "12345678" , string(buf[:__u64toa(&buf[0], 12345678)]))
assert.Equal(t, "123456789" , string(buf[:__u64toa(&buf[0], 123456789)]))
assert.Equal(t, "1234567890" , string(buf[:__u64toa(&buf[0], 1234567890)]))
assert.Equal(t, "12345678901" , string(buf[:__u64toa(&buf[0], 12345678901)]))
assert.Equal(t, "123456789012" , string(buf[:__u64toa(&buf[0], 123456789012)]))
assert.Equal(t, "1234567890123" , string(buf[:__u64toa(&buf[0], 1234567890123)]))
assert.Equal(t, "12345678901234" , string(buf[:__u64toa(&buf[0], 12345678901234)]))
assert.Equal(t, "123456789012345" , string(buf[:__u64toa(&buf[0], 123456789012345)]))
assert.Equal(t, "1234567890123456" , string(buf[:__u64toa(&buf[0], 1234567890123456)]))
assert.Equal(t, "12345678901234567" , string(buf[:__u64toa(&buf[0], 12345678901234567)]))
assert.Equal(t, "123456789012345678" , string(buf[:__u64toa(&buf[0], 123456789012345678)]))
assert.Equal(t, "1234567890123456789" , string(buf[:__u64toa(&buf[0], 1234567890123456789)]))
assert.Equal(t, "12345678901234567890" , string(buf[:__u64toa(&buf[0], 12345678901234567890)]))
assert.Equal(t, "18446744073709551615" , string(buf[:__u64toa(&buf[0], 18446744073709551615)]))
assert.Equal(t, "0" , string(buf[:u64toa(&buf[0], 0)]))
assert.Equal(t, "1" , string(buf[:u64toa(&buf[0], 1)]))
assert.Equal(t, "12" , string(buf[:u64toa(&buf[0], 12)]))
assert.Equal(t, "123" , string(buf[:u64toa(&buf[0], 123)]))
assert.Equal(t, "1234" , string(buf[:u64toa(&buf[0], 1234)]))
assert.Equal(t, "12345" , string(buf[:u64toa(&buf[0], 12345)]))
assert.Equal(t, "123456" , string(buf[:u64toa(&buf[0], 123456)]))
assert.Equal(t, "1234567" , string(buf[:u64toa(&buf[0], 1234567)]))
assert.Equal(t, "12345678" , string(buf[:u64toa(&buf[0], 12345678)]))
assert.Equal(t, "123456789" , string(buf[:u64toa(&buf[0], 123456789)]))
assert.Equal(t, "1234567890" , string(buf[:u64toa(&buf[0], 1234567890)]))
assert.Equal(t, "12345678901" , string(buf[:u64toa(&buf[0], 12345678901)]))
assert.Equal(t, "123456789012" , string(buf[:u64toa(&buf[0], 123456789012)]))
assert.Equal(t, "1234567890123" , string(buf[:u64toa(&buf[0], 1234567890123)]))
assert.Equal(t, "12345678901234" , string(buf[:u64toa(&buf[0], 12345678901234)]))
assert.Equal(t, "123456789012345" , string(buf[:u64toa(&buf[0], 123456789012345)]))
assert.Equal(t, "1234567890123456" , string(buf[:u64toa(&buf[0], 1234567890123456)]))
assert.Equal(t, "12345678901234567" , string(buf[:u64toa(&buf[0], 12345678901234567)]))
assert.Equal(t, "123456789012345678" , string(buf[:u64toa(&buf[0], 123456789012345678)]))
assert.Equal(t, "1234567890123456789" , string(buf[:u64toa(&buf[0], 1234567890123456789)]))
assert.Equal(t, "12345678901234567890" , string(buf[:u64toa(&buf[0], 12345678901234567890)]))
assert.Equal(t, "18446744073709551615" , string(buf[:u64toa(&buf[0], 18446744073709551615)]))
}
func BenchmarkFastInt_IntToString(b *testing.B) {
func BenchmarkFastInt_IntToString(b *testing.B) {
benchmarks := []struct {
name string
test func(*testing.B)
@@ -107,22 +109,22 @@ func TestFastInt_UintToString(t *testing.T) {
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { strconv.AppendInt(buf[:0], -int64(i), 10) }},
}, {
name: "FastInt-Positive",
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { __i64toa(&buf[0], int64(i)) }},
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { i64toa(&buf[0], int64(i)) }},
}, {
name: "FastInt-Negative",
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { __i64toa(&buf[0], -int64(i)) }},
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { i64toa(&buf[0], -int64(i)) }},
}}
for _, bm := range benchmarks {
b.Run(bm.name, bm.test)
}
}
}
type utoaBench struct {
type utoaBench struct {
name string
num uint64
}
}
func BenchmarkFastInt_UintToString(b *testing.B) {
func BenchmarkFastInt_UintToString(b *testing.B) {
maxUint := "18446744073709551615"
benchs := make([]utoaBench, len(maxUint) + 1)
benchs[0].name = "Zero"
@@ -141,11 +143,11 @@ func TestFastInt_UintToString(t *testing.T) {
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { strconv.AppendUint(buf[:0], t.num, 10) }},
}, {
name: "FastInt",
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { __u64toa(&buf[0], t.num) }},
test: func(b *testing.B) { var buf [32]byte; for i := 0; i < b.N; i++ { u64toa(&buf[0], t.num) }},
}}
for _, bm := range benchmarks {
name := fmt.Sprintf("%s_%s", bm.name, t.name)
b.Run(name, bm.test)
}
}
}
}

View File

@@ -1,3 +1,5 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -20,114 +22,168 @@ import (
`unsafe`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/internal/rt`
)
var (
__i64toa func(out unsafe.Pointer, val int64) (ret int)
__u64toa func(out unsafe.Pointer, val uint64) (ret int)
__f64toa func(out unsafe.Pointer, val float64) (ret int)
__f32toa func(out unsafe.Pointer, val float32) (ret int)
__lspace func(sp unsafe.Pointer, nb int, off int) (ret int)
__quote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer, flags uint64) (ret int)
__html_escape func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer) (ret int)
__unquote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep unsafe.Pointer, flags uint64) (ret int)
__value func(s unsafe.Pointer, n int, p int, v unsafe.Pointer, flags uint64) (ret int)
__vstring func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer, flags uint64)
__vnumber func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vunsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__skip_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_one_fast func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__skip_array func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_object func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_number func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__validate_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__get_by_path func(s unsafe.Pointer, p unsafe.Pointer, path unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8 func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8_fast func(s unsafe.Pointer) (ret int)
__fsm_exec func(m unsafe.Pointer, s unsafe.Pointer, p unsafe.Pointer, flags uint64) (ret int)
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __i64toa(out *byte, val int64) (ret int)
func i64toa(out *byte, val int64) (ret int) {
return __i64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __u64toa(out *byte, val uint64) (ret int)
func u64toa(out *byte, val uint64) (ret int) {
return __u64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f64toa(out *byte, val float64) (ret int)
func f64toa(out *byte, val float64) (ret int) {
return __f64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f32toa(out *byte, val float32) (ret int)
func f32toa(out *byte, val float32) (ret int) {
return __f32toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __lspace(sp unsafe.Pointer, nb int, off int) (ret int)
func lspace(sp unsafe.Pointer, nb int, off int) (ret int) {
return __lspace(rt.NoEscape(sp), nb, off)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int)
func quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int) {
return __quote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int)
func html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int) {
return __html_escape(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int)
func unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int) {
return __unquote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(ep)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int)
func value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int) {
return __value(rt.NoEscape(unsafe.Pointer(s)), n, p, rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vstring(s *string, p *int, v *types.JsonState, flags uint64)
func vstring(s *string, p *int, v *types.JsonState, flags uint64) {
__vstring(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vnumber(s *string, p *int, v *types.JsonState)
func vnumber(s *string, p *int, v *types.JsonState) {
__vnumber(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vsigned(s *string, p *int, v *types.JsonState)
func vsigned(s *string, p *int, v *types.JsonState) {
__vsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vunsigned(s *string, p *int, v *types.JsonState)
func vunsigned(s *string, p *int, v *types.JsonState) {
__vunsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one_fast(s *string, p *int) (ret int)
func skip_one_fast(s *string, p *int) (ret int) {
return __skip_one_fast(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_array(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_object(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_number(s *string, p *int) (ret int)
func skip_number(s *string, p *int) (ret int) {
return __skip_number(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_one(s *string, p *int, m *types.StateMachine) (ret int)
func validate_one(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int)
func get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int) {
return __get_by_path(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(path)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8(s *string, p *int, m *types.StateMachine) (ret int)
func validate_utf8(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_utf8(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8_fast(s *string) (ret int)
func validate_utf8_fast(s *string) (ret int) {
return __validate_utf8_fast(rt.NoEscape(unsafe.Pointer(s)))
}
//go:nosplit
func fsm_exec(m *types.StateMachine, s *string, p *int, flags uint64) (ret int) {
return __fsm_exec(rt.NoEscape(unsafe.Pointer(m)), rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), flags)
}

View File

@@ -1,3 +1,5 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -20,6 +22,7 @@ import (
`encoding/hex`
`fmt`
`math`
`strings`
`testing`
`unsafe`
@@ -34,7 +37,7 @@ func TestNative_Value(t *testing.T) {
var v types.JsonState
s := ` -12345`
p := (*rt.GoString)(unsafe.Pointer(&s))
x := __value(p.Ptr, p.Len, 0, &v, 0)
x := value(p.Ptr, p.Len, 0, &v, 0)
assert.Equal(t, 9, x)
assert.Equal(t, types.V_INTEGER, v.Vt)
assert.Equal(t, int64(-12345), v.Iv)
@@ -46,7 +49,7 @@ func TestNative_Value_OutOfBound(t *testing.T) {
mem := []byte{'"', '"'}
s := rt.Mem2Str(mem[:1])
p := (*rt.GoString)(unsafe.Pointer(&s))
x := __value(p.Ptr, p.Len, 0, &v, 0)
x := value(p.Ptr, p.Len, 0, &v, 0)
assert.Equal(t, 1, x)
assert.Equal(t, -int(types.ERR_EOF), int(v.Vt))
}
@@ -56,7 +59,7 @@ func TestNative_Quote(t *testing.T) {
d := make([]byte, 256)
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __quote(sp.Ptr, sp.Len, dp.Ptr, &dp.Len, 0)
rv := quote(sp.Ptr, sp.Len, dp.Ptr, &dp.Len, 0)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -70,7 +73,7 @@ func TestNative_QuoteNoMem(t *testing.T) {
d := make([]byte, 10)
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __quote(sp.Ptr, sp.Len, dp.Ptr, &dp.Len, 0)
rv := quote(sp.Ptr, sp.Len, dp.Ptr, &dp.Len, 0)
assert.Equal(t, -6, rv)
assert.Equal(t, 5, len(d))
assert.Equal(t, `hello`, string(d))
@@ -81,7 +84,7 @@ func TestNative_DoubleQuote(t *testing.T) {
d := make([]byte, 256)
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __quote(sp.Ptr, sp.Len, dp.Ptr, &dp.Len, types.F_DOUBLE_UNQUOTE)
rv := quote(sp.Ptr, sp.Len, dp.Ptr, &dp.Len, types.F_DOUBLE_UNQUOTE)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -96,7 +99,7 @@ func TestNative_Unquote(t *testing.T) {
ep := -1
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
rv := unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -111,7 +114,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep := -1
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
rv := unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
assert.Equal(t, -int(types.ERR_EOF), rv)
assert.Equal(t, 5, ep)
s = `asdf\gqwer`
@@ -119,7 +122,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
assert.Equal(t, -int(types.ERR_INVALID_ESCAPE), rv)
assert.Equal(t, 5, ep)
s = `asdf\u1gggqwer`
@@ -127,7 +130,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
assert.Equal(t, -int(types.ERR_INVALID_CHAR), rv)
assert.Equal(t, 7, ep)
s = `asdf\ud800qwer`
@@ -135,7 +138,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
assert.Equal(t, -int(types.ERR_INVALID_UNICODE), rv)
assert.Equal(t, 6, ep)
s = `asdf\\ud800qwer`
@@ -143,7 +146,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_DOUBLE_UNQUOTE)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_DOUBLE_UNQUOTE)
assert.Equal(t, -int(types.ERR_INVALID_UNICODE), rv)
assert.Equal(t, 7, ep)
s = `asdf\ud800\ud800qwer`
@@ -151,7 +154,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, 0)
assert.Equal(t, -int(types.ERR_INVALID_UNICODE), rv)
assert.Equal(t, 12, ep)
s = `asdf\\ud800\\ud800qwer`
@@ -159,7 +162,7 @@ func TestNative_UnquoteError(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_DOUBLE_UNQUOTE)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_DOUBLE_UNQUOTE)
assert.Equal(t, -int(types.ERR_INVALID_UNICODE), rv)
assert.Equal(t, 14, ep)
}
@@ -170,7 +173,7 @@ func TestNative_DoubleUnquote(t *testing.T) {
ep := -1
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_DOUBLE_UNQUOTE)
rv := unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_DOUBLE_UNQUOTE)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -185,7 +188,7 @@ func TestNative_UnquoteUnicodeReplacement(t *testing.T) {
ep := -1
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_UNICODE_REPLACE)
rv := unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_UNICODE_REPLACE)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -197,7 +200,7 @@ func TestNative_UnquoteUnicodeReplacement(t *testing.T) {
ep = -1
dp = (*rt.GoSlice)(unsafe.Pointer(&d))
sp = (*rt.GoString)(unsafe.Pointer(&s))
rv = __unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_UNICODE_REPLACE)
rv = unquote(sp.Ptr, sp.Len, dp.Ptr, &ep, types.F_UNICODE_REPLACE)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -211,7 +214,7 @@ func TestNative_HTMLEscape(t *testing.T) {
d := make([]byte, 256)
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __html_escape(sp.Ptr, sp.Len, dp.Ptr, &dp.Len)
rv := html_escape(sp.Ptr, sp.Len, dp.Ptr, &dp.Len)
if rv < 0 {
require.NoError(t, types.ParsingError(-rv))
}
@@ -225,7 +228,7 @@ func TestNative_HTMLEscapeNoMem(t *testing.T) {
d := make([]byte, 10)
dp := (*rt.GoSlice)(unsafe.Pointer(&d))
sp := (*rt.GoString)(unsafe.Pointer(&s))
rv := __html_escape(sp.Ptr, sp.Len, dp.Ptr, &dp.Len)
rv := html_escape(sp.Ptr, sp.Len, dp.Ptr, &dp.Len)
assert.Equal(t, -6, rv)
assert.Equal(t, 5, len(d))
assert.Equal(t, `hello`, string(d))
@@ -235,11 +238,11 @@ func TestNative_Vstring(t *testing.T) {
var v types.JsonState
i := 0
s := `test"test\n2"`
__vstring(&s, &i, &v, 0)
vstring(&s, &i, &v, 0)
assert.Equal(t, 5, i)
assert.Equal(t, -1, v.Ep)
assert.Equal(t, int64(0), v.Iv)
__vstring(&s, &i, &v, 0)
vstring(&s, &i, &v, 0)
assert.Equal(t, 13, i)
assert.Equal(t, 9, v.Ep)
assert.Equal(t, int64(5), v.Iv)
@@ -250,7 +253,7 @@ func TestNative_Vstring_ValidUnescapedChars(t *testing.T) {
valid := uint64(types.F_VALIDATE_STRING)
i := 0
s := "test\x1f\""
__vstring(&s, &i, &v, valid)
vstring(&s, &i, &v, valid)
assert.Equal(t, -int(types.ERR_INVALID_CHAR), int(v.Vt))
}
@@ -258,7 +261,7 @@ func TestNative_VstringEscapeEOF(t *testing.T) {
var v types.JsonState
i := 0
s := `xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx\"xxxxxxxxxxxxxxxxxxxxxxxxxxxxx"x`
__vstring(&s, &i, &v, 0)
vstring(&s, &i, &v, 0)
assert.Equal(t, 95, i)
assert.Equal(t, 63, v.Ep)
assert.Equal(t, int64(0), v.Iv)
@@ -274,7 +277,7 @@ func TestNative_VstringHangUpOnRandomData(t *testing.T) {
p := 1
s := rt.Mem2Str(v)
var js types.JsonState
__vstring(&s, &p, &js, 0)
vstring(&s, &p, &js, 0)
fmt.Printf("js: %s\n", spew.Sdump(js))
}
@@ -282,49 +285,49 @@ func TestNative_Vnumber(t *testing.T) {
var v types.JsonState
i := 0
s := "1234"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 4, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, int64(1234), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "1.234"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 5, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, 1.234, v.Dv)
assert.Equal(t, types.V_DOUBLE, v.Vt)
i = 0
s = "1.234e5"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 7, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, 1.234e5, v.Dv)
assert.Equal(t, types.V_DOUBLE, v.Vt)
i = 0
s = "0.0125"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 6, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, 0.0125, v.Dv)
assert.Equal(t, types.V_DOUBLE, v.Vt)
i = 0
s = "100000000000000000000"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 21, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, 100000000000000000000.0, v.Dv)
assert.Equal(t, types.V_DOUBLE, v.Vt)
i = 0
s = "999999999999999900000"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 21, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, 999999999999999900000.0, v.Dv)
assert.Equal(t, types.V_DOUBLE, v.Vt)
i = 0
s = "-1.234"
__vnumber(&s, &i, &v)
vnumber(&s, &i, &v)
assert.Equal(t, 6, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, -1.234, v.Dv)
@@ -335,65 +338,65 @@ func TestNative_Vsigned(t *testing.T) {
var v types.JsonState
i := 0
s := "1234"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 4, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, int64(1234), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "-1234"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 5, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, int64(-1234), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "9223372036854775807"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 19, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, int64(math.MaxInt64), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "-9223372036854775808"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 20, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, int64(math.MinInt64), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "9223372036854775808"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 18, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INTEGER_OVERFLOW)), v.Vt)
i = 0
s = "-9223372036854775809"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 19, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INTEGER_OVERFLOW)), v.Vt)
i = 0
s = "1.234"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 1, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "0.0125"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 1, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "-1234e5"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 5, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "-1234e-5"
__vsigned(&s, &i, &v)
vsigned(&s, &i, &v)
assert.Equal(t, 5, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
@@ -403,63 +406,63 @@ func TestNative_Vunsigned(t *testing.T) {
var v types.JsonState
i := 0
s := "1234"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 4, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, int64(1234), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "18446744073709551615"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 20, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, ^int64(0), v.Iv)
assert.Equal(t, types.V_INTEGER, v.Vt)
i = 0
s = "18446744073709551616"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 19, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INTEGER_OVERFLOW)), v.Vt)
i = 0
s = "-1234"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 0, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "1.234"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 1, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "0.0125"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 1, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "1234e5"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 4, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "-1234e5"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 0, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "-1.234e5"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 0, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
i = 0
s = "-1.234e-5"
__vunsigned(&s, &i, &v)
vunsigned(&s, &i, &v)
assert.Equal(t, 0, i)
assert.Equal(t, 0, v.Ep)
assert.Equal(t, types.ValueType(-int(types.ERR_INVALID_NUMBER_FMT)), v.Vt)
@@ -468,36 +471,36 @@ func TestNative_Vunsigned(t *testing.T) {
func TestNative_SkipOne(t *testing.T) {
p := 0
s := ` {"asdf": [null, true, false, 1, 2.0, -3]}, 1234.5`
q := __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q := skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 42, p)
assert.Equal(t, 1, q)
p = 0
s = `1 2.5 -3 "asdf\nqwer" true false null {} []`
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 1, p)
assert.Equal(t, 0, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 5, p)
assert.Equal(t, 2, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 8, p)
assert.Equal(t, 6, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 21, p)
assert.Equal(t, 9, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 26, p)
assert.Equal(t, 22, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 32, p)
assert.Equal(t, 27, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 37, p)
assert.Equal(t, 33, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 40, p)
assert.Equal(t, 38, q)
q = __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q = skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, 43, p)
assert.Equal(t, 41, q)
}
@@ -509,7 +512,7 @@ func TestNative_SkipOne_Error(t *testing.T) {
`"asdf`, `"\\\"`,
}) {
p := 0
q := __skip_one(&s, &p, &types.StateMachine{}, uint64(0))
q := skip_one(&s, &p, &types.StateMachine{}, uint64(0))
assert.True(t, q < 0)
}
}
@@ -517,21 +520,21 @@ func TestNative_SkipOne_Error(t *testing.T) {
func TestNative_SkipArray(t *testing.T) {
p := 0
s := `null, true, false, 1, 2.0, -3, {"asdf": "wqer"}],`
__skip_array(&s, &p, &types.StateMachine{}, uint64(0))
skip_array(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, p, 48)
}
func TestNative_SkipObject(t *testing.T) {
p := 0
s := `"asdf": "wqer"},`
__skip_object(&s, &p, &types.StateMachine{}, uint64(0))
skip_object(&s, &p, &types.StateMachine{}, uint64(0))
assert.Equal(t, p, 15)
}
func TestNative_SkipNumber(t *testing.T) {
p := 0
s := `-1.23e+12`
q := __skip_number(&s, &p)
q := skip_number(&s, &p)
assert.Equal(t, 9, p)
assert.Equal(t, 0, q)
}
@@ -539,44 +542,44 @@ func TestNative_SkipNumber(t *testing.T) {
func TestNative_SkipOneFast(t *testing.T) {
p := 0
s := ` {"asdf": [null, true, false, 1, 2.0, -3]}, 1234.5`
q := __skip_one_fast(&s, &p)
q := skip_one_fast(&s, &p)
assert.Equal(t, 42, p)
assert.Equal(t, 1, q)
p = 0
s = `1, 2.5, -3, "asdf\nqwer", true, false, null, {}, [],`
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 1, p)
assert.Equal(t, 0, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 6, p)
assert.Equal(t, 3, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 10, p)
assert.Equal(t, 8, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 24, p)
assert.Equal(t, 12, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 30, p)
assert.Equal(t, 26, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 37, p)
assert.Equal(t, 32, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 43, p)
assert.Equal(t, 39, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 47, p)
assert.Equal(t, 45, q)
p += 1
q = __skip_one_fast(&s, &p)
q = skip_one_fast(&s, &p)
assert.Equal(t, 51, p)
assert.Equal(t, 49, q)
}
@@ -587,7 +590,36 @@ func TestNative_SkipOneFast_Error(t *testing.T) {
`"asdf`, `"\\\"`,
}) {
p := 0
q := __skip_one_fast(&s, &p)
q := skip_one_fast(&s, &p)
assert.True(t, q < 0)
}
}
func TestNative_GetByPath(t *testing.T) {
s := `{"asdf": [null, true, false, 1, 2.0, -3]}, 1234.5`
p := 0
path := []interface{}{"asdf", 4}
ret := get_by_path(&s, &p, &path, types.NewStateMachine())
assert.Equal(t, strings.Index(s, "2.0"), ret)
}
func BenchmarkNative_SkipOneFast(b *testing.B) {
b.ResetTimer()
for i:=0; i<b.N; i++ {
s := `{"asdf": [null, true, false, 1, 2.0, -3]}, 1234.5`
p := 0
_ = skip_one_fast(&s, &p)
}
}
func BenchmarkNative_GetByPath(b *testing.B) {
b.ResetTimer()
for i:=0; i<b.N; i++ {
s := `{"asdf": [null, true, false, 1, 2.0, -3]}, 1234.5`
p := 0
path := []interface{}{"asdf", 3}
sm := types.NewStateMachine()
_ = get_by_path(&s, &p, &path, sm)
types.FreeStateMachine(sm)
}
}

View File

@@ -1,47 +0,0 @@
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package {{PACKAGE}}
var (
S_f64toa = _subr__f64toa
S_f32toa = _subr__f32toa
S_i64toa = _subr__i64toa
S_u64toa = _subr__u64toa
S_lspace = _subr__lspace
)
var (
S_quote = _subr__quote
S_unquote = _subr__unquote
)
var (
S_value = _subr__value
S_vstring = _subr__vstring
S_vnumber = _subr__vnumber
S_vsigned = _subr__vsigned
S_vunsigned = _subr__vunsigned
)
var (
S_skip_one = _subr__skip_one
S_skip_one_fast = _subr__skip_one_fast
S_skip_array = _subr__skip_array
S_skip_object = _subr__skip_object
S_skip_number = _subr__skip_number
S_get_by_path = _subr__get_by_path
)

View File

@@ -1,5 +1,7 @@
// Code generated by Makefile, DO NOT EDIT.
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
@@ -22,114 +24,168 @@ import (
`unsafe`
`github.com/bytedance/sonic/internal/native/types`
`github.com/bytedance/sonic/internal/rt`
)
var (
__i64toa func(out unsafe.Pointer, val int64) (ret int)
__u64toa func(out unsafe.Pointer, val uint64) (ret int)
__f64toa func(out unsafe.Pointer, val float64) (ret int)
__f32toa func(out unsafe.Pointer, val float32) (ret int)
__lspace func(sp unsafe.Pointer, nb int, off int) (ret int)
__quote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer, flags uint64) (ret int)
__html_escape func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn unsafe.Pointer) (ret int)
__unquote func(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep unsafe.Pointer, flags uint64) (ret int)
__value func(s unsafe.Pointer, n int, p int, v unsafe.Pointer, flags uint64) (ret int)
__vstring func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer, flags uint64)
__vnumber func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__vunsigned func(s unsafe.Pointer, p unsafe.Pointer, v unsafe.Pointer)
__skip_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_one_fast func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__skip_array func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_object func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer, flags uint64) (ret int)
__skip_number func(s unsafe.Pointer, p unsafe.Pointer) (ret int)
__validate_one func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__get_by_path func(s unsafe.Pointer, p unsafe.Pointer, path unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8 func(s unsafe.Pointer, p unsafe.Pointer, m unsafe.Pointer) (ret int)
__validate_utf8_fast func(s unsafe.Pointer) (ret int)
__fsm_exec func(m unsafe.Pointer, s unsafe.Pointer, p unsafe.Pointer, flags uint64) (ret int)
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __i64toa(out *byte, val int64) (ret int)
func i64toa(out *byte, val int64) (ret int) {
return __i64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __u64toa(out *byte, val uint64) (ret int)
func u64toa(out *byte, val uint64) (ret int) {
return __u64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f64toa(out *byte, val float64) (ret int)
func f64toa(out *byte, val float64) (ret int) {
return __f64toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __f32toa(out *byte, val float32) (ret int)
func f32toa(out *byte, val float32) (ret int) {
return __f32toa(rt.NoEscape(unsafe.Pointer(out)), val)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __lspace(sp unsafe.Pointer, nb int, off int) (ret int)
func lspace(sp unsafe.Pointer, nb int, off int) (ret int) {
return __lspace(rt.NoEscape(sp), nb, off)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int)
func quote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int, flags uint64) (ret int) {
return __quote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int)
func html_escape(sp unsafe.Pointer, nb int, dp unsafe.Pointer, dn *int) (ret int) {
return __html_escape(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(dn)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int)
func unquote(sp unsafe.Pointer, nb int, dp unsafe.Pointer, ep *int, flags uint64) (ret int) {
return __unquote(rt.NoEscape(unsafe.Pointer(sp)), nb, rt.NoEscape(unsafe.Pointer(dp)), rt.NoEscape(unsafe.Pointer(ep)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int)
func value(s unsafe.Pointer, n int, p int, v *types.JsonState, flags uint64) (ret int) {
return __value(rt.NoEscape(unsafe.Pointer(s)), n, p, rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vstring(s *string, p *int, v *types.JsonState, flags uint64)
func vstring(s *string, p *int, v *types.JsonState, flags uint64) {
__vstring(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vnumber(s *string, p *int, v *types.JsonState)
func vnumber(s *string, p *int, v *types.JsonState) {
__vnumber(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vsigned(s *string, p *int, v *types.JsonState)
func vsigned(s *string, p *int, v *types.JsonState) {
__vsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __vunsigned(s *string, p *int, v *types.JsonState)
func vunsigned(s *string, p *int, v *types.JsonState) {
__vunsigned(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(v)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_one(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_one_fast(s *string, p *int) (ret int)
func skip_one_fast(s *string, p *int) (ret int) {
return __skip_one_fast(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_array(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_array(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int)
func skip_object(s *string, p *int, m *types.StateMachine, flags uint64) (ret int) {
return __skip_object(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)), flags)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __skip_number(s *string, p *int) (ret int)
func skip_number(s *string, p *int) (ret int) {
return __skip_number(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_one(s *string, p *int, m *types.StateMachine) (ret int)
func validate_one(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_one(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int)
func get_by_path(s *string, p *int, path *[]interface{}, m *types.StateMachine) (ret int) {
return __get_by_path(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(path)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8(s *string, p *int, m *types.StateMachine) (ret int)
func validate_utf8(s *string, p *int, m *types.StateMachine) (ret int) {
return __validate_utf8(rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), rt.NoEscape(unsafe.Pointer(m)))
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __validate_utf8_fast(s *string) (ret int)
func validate_utf8_fast(s *string) (ret int) {
return __validate_utf8_fast(rt.NoEscape(unsafe.Pointer(s)))
}
//go:nosplit
func fsm_exec(m *types.StateMachine, s *string, p *int, flags uint64) (ret int) {
return __fsm_exec(rt.NoEscape(unsafe.Pointer(m)), rt.NoEscape(unsafe.Pointer(s)), rt.NoEscape(unsafe.Pointer(p)), flags)
}

File diff suppressed because it is too large Load Diff

View File

@@ -1,49 +0,0 @@
// Code generated by Makefile, DO NOT EDIT.
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package sse
var (
S_f64toa = _subr__f64toa
S_f32toa = _subr__f32toa
S_i64toa = _subr__i64toa
S_u64toa = _subr__u64toa
S_lspace = _subr__lspace
)
var (
S_quote = _subr__quote
S_unquote = _subr__unquote
)
var (
S_value = _subr__value
S_vstring = _subr__vstring
S_vnumber = _subr__vnumber
S_vsigned = _subr__vsigned
S_vunsigned = _subr__vunsigned
)
var (
S_skip_one = _subr__skip_one
S_skip_one_fast = _subr__skip_one_fast
S_skip_array = _subr__skip_array
S_skip_object = _subr__skip_object
S_skip_number = _subr__skip_number
S_get_by_path = _subr__get_by_path
)

View File

@@ -3,107 +3,602 @@
package sse
//go:nosplit
//go:noescape
//goland:noinspection ALL
func __native_entry__() uintptr
import (
`github.com/bytedance/sonic/loader`
)
var (
_subr__f32toa = __native_entry__() + 31760
_subr__f64toa = __native_entry__() + 160
_subr__get_by_path = __native_entry__() + 26384
_subr__html_escape = __native_entry__() + 9072
_subr__i64toa = __native_entry__() + 3424
_subr__lspace = __native_entry__() + 16
_subr__quote = __native_entry__() + 4864
_subr__skip_array = __native_entry__() + 18112
_subr__skip_number = __native_entry__() + 22128
_subr__skip_object = __native_entry__() + 20512
_subr__skip_one = __native_entry__() + 22288
_subr__skip_one_fast = __native_entry__() + 22512
_subr__u64toa = __native_entry__() + 3552
_subr__unquote = __native_entry__() + 6704
_subr__validate_one = __native_entry__() + 22336
_subr__validate_utf8 = __native_entry__() + 30528
_subr__validate_utf8_fast = __native_entry__() + 31200
_subr__value = __native_entry__() + 12272
_subr__vnumber = __native_entry__() + 15728
_subr__vsigned = __native_entry__() + 17376
_subr__vstring = __native_entry__() + 14112
_subr__vunsigned = __native_entry__() + 17760
const (
_entry__f32toa = 31616
_entry__f64toa = 160
_entry__format_significand = 35888
_entry__format_integer = 2960
_entry__fsm_exec = 18016
_entry__advance_string = 14352
_entry__advance_string_default = 37280
_entry__do_skip_number = 20608
_entry__get_by_path = 26176
_entry__skip_one_fast = 22272
_entry__html_escape = 8912
_entry__i64toa = 3392
_entry__u64toa = 3520
_entry__lspace = 16
_entry__quote = 4832
_entry__skip_array = 17984
_entry__skip_number = 21904
_entry__skip_object = 20256
_entry__skip_one = 22048
_entry__unquote = 6576
_entry__validate_one = 22096
_entry__validate_utf8 = 30384
_entry__validate_utf8_fast = 31056
_entry__value = 12352
_entry__vnumber = 15744
_entry__atof_eisel_lemire64 = 10192
_entry__atof_native = 11744
_entry__decimal_to_f64 = 10560
_entry__right_shift = 36848
_entry__left_shift = 36352
_entry__vsigned = 17296
_entry__vstring = 14176
_entry__vunsigned = 17632
)
const (
_stack__f32toa = 48
_stack__f64toa = 80
_stack__get_by_path = 240
_stack__html_escape = 64
_stack__format_significand = 24
_stack__format_integer = 16
_stack__fsm_exec = 168
_stack__advance_string = 64
_stack__advance_string_default = 64
_stack__do_skip_number = 48
_stack__get_by_path = 272
_stack__skip_one_fast = 136
_stack__html_escape = 72
_stack__i64toa = 16
_stack__u64toa = 8
_stack__lspace = 8
_stack__quote = 64
_stack__skip_array = 128
_stack__skip_number = 72
_stack__skip_object = 128
_stack__skip_one = 128
_stack__skip_one_fast = 136
_stack__u64toa = 8
_stack__skip_array = 176
_stack__skip_number = 88
_stack__skip_object = 176
_stack__skip_one = 176
_stack__unquote = 88
_stack__validate_one = 128
_stack__validate_one = 176
_stack__validate_utf8 = 48
_stack__validate_utf8_fast = 24
_stack__value = 328
_stack__vnumber = 240
_stack__atof_eisel_lemire64 = 32
_stack__atof_native = 136
_stack__decimal_to_f64 = 80
_stack__right_shift = 8
_stack__left_shift = 24
_stack__vsigned = 16
_stack__vstring = 136
_stack__vunsigned = 16
)
var (
_ = _subr__f32toa
_ = _subr__f64toa
_ = _subr__get_by_path
_ = _subr__html_escape
_ = _subr__i64toa
_ = _subr__lspace
_ = _subr__quote
_ = _subr__skip_array
_ = _subr__skip_number
_ = _subr__skip_object
_ = _subr__skip_one
_ = _subr__skip_one_fast
_ = _subr__u64toa
_ = _subr__unquote
_ = _subr__validate_one
_ = _subr__validate_utf8
_ = _subr__validate_utf8_fast
_ = _subr__value
_ = _subr__vnumber
_ = _subr__vsigned
_ = _subr__vstring
_ = _subr__vunsigned
_stack__vstring = 120
_stack__vunsigned = 8
)
const (
_ = _stack__f32toa
_ = _stack__f64toa
_ = _stack__get_by_path
_ = _stack__html_escape
_ = _stack__i64toa
_ = _stack__lspace
_ = _stack__quote
_ = _stack__skip_array
_ = _stack__skip_number
_ = _stack__skip_object
_ = _stack__skip_one
_ = _stack__skip_one_fast
_ = _stack__u64toa
_ = _stack__unquote
_ = _stack__validate_one
_ = _stack__validate_utf8
_ = _stack__validate_utf8_fast
_ = _stack__value
_ = _stack__vnumber
_ = _stack__vsigned
_ = _stack__vstring
_ = _stack__vunsigned
_size__f32toa = 3328
_size__f64toa = 2800
_size__format_significand = 464
_size__format_integer = 432
_size__fsm_exec = 1692
_size__advance_string = 1344
_size__advance_string_default = 960
_size__do_skip_number = 956
_size__get_by_path = 4208
_size__skip_one_fast = 3404
_size__html_escape = 1280
_size__i64toa = 48
_size__u64toa = 1264
_size__lspace = 128
_size__quote = 1728
_size__skip_array = 32
_size__skip_number = 144
_size__skip_object = 32
_size__skip_one = 48
_size__unquote = 2272
_size__validate_one = 48
_size__validate_utf8 = 672
_size__validate_utf8_fast = 544
_size__value = 1316
_size__vnumber = 1552
_size__atof_eisel_lemire64 = 368
_size__atof_native = 608
_size__decimal_to_f64 = 1184
_size__right_shift = 400
_size__left_shift = 496
_size__vsigned = 336
_size__vstring = 128
_size__vunsigned = 336
)
var (
_pcsp__f32toa = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{3286, 48},
{3287, 40},
{3289, 32},
{3291, 24},
{3293, 16},
{3295, 8},
{3296, 0},
{3318, 48},
}
_pcsp__f64toa = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{2740, 56},
{2744, 48},
{2745, 40},
{2747, 32},
{2749, 24},
{2751, 16},
{2753, 8},
{2754, 0},
{2792, 56},
}
_pcsp__format_significand = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{452, 24},
{453, 16},
{455, 8},
{457, 0},
}
_pcsp__format_integer = [][2]uint32{
{1, 0},
{4, 8},
{412, 16},
{413, 8},
{414, 0},
{423, 16},
{424, 8},
{426, 0},
}
_pcsp__fsm_exec = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1342, 104},
{1346, 48},
{1347, 40},
{1349, 32},
{1351, 24},
{1353, 16},
{1355, 8},
{1356, 0},
{1692, 104},
}
_pcsp__advance_string = [][2]uint32{
{14, 0},
{18, 8},
{20, 16},
{22, 24},
{24, 32},
{26, 40},
{27, 48},
{614, 56},
{618, 48},
{619, 40},
{621, 32},
{623, 24},
{625, 16},
{627, 8},
{628, 0},
{1339, 56},
}
_pcsp__advance_string_default = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{576, 64},
{580, 48},
{581, 40},
{583, 32},
{585, 24},
{587, 16},
{589, 8},
{590, 0},
{955, 64},
}
_pcsp__do_skip_number = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{881, 48},
{882, 40},
{884, 32},
{886, 24},
{888, 16},
{890, 8},
{891, 0},
{956, 48},
}
_pcsp__get_by_path = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{4012, 104},
{4016, 48},
{4017, 40},
{4019, 32},
{4021, 24},
{4023, 16},
{4025, 8},
{4026, 0},
{4194, 104},
}
_pcsp__skip_one_fast = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{658, 136},
{662, 48},
{663, 40},
{665, 32},
{667, 24},
{669, 16},
{671, 8},
{672, 0},
{3404, 136},
}
_pcsp__html_escape = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1256, 72},
{1260, 48},
{1261, 40},
{1263, 32},
{1265, 24},
{1267, 16},
{1269, 8},
{1271, 0},
}
_pcsp__i64toa = [][2]uint32{
{14, 0},
{34, 8},
{36, 0},
}
_pcsp__u64toa = [][2]uint32{
{1, 0},
{161, 8},
{162, 0},
{457, 8},
{458, 0},
{772, 8},
{773, 0},
{1249, 8},
{1251, 0},
}
_pcsp__lspace = [][2]uint32{
{1, 0},
{89, 8},
{90, 0},
{103, 8},
{104, 0},
{111, 8},
{113, 0},
}
_pcsp__quote = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1681, 64},
{1685, 48},
{1686, 40},
{1688, 32},
{1690, 24},
{1692, 16},
{1694, 8},
{1695, 0},
{1722, 64},
}
_pcsp__skip_array = [][2]uint32{
{1, 0},
{26, 8},
{32, 0},
}
_pcsp__skip_number = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{100, 40},
{101, 32},
{103, 24},
{105, 16},
{107, 8},
{108, 0},
{139, 40},
}
_pcsp__skip_object = [][2]uint32{
{1, 0},
{26, 8},
{32, 0},
}
_pcsp__skip_one = [][2]uint32{
{1, 0},
{30, 8},
{36, 0},
}
_pcsp__unquote = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1684, 88},
{1688, 48},
{1689, 40},
{1691, 32},
{1693, 24},
{1695, 16},
{1697, 8},
{1698, 0},
{2270, 88},
}
_pcsp__validate_one = [][2]uint32{
{1, 0},
{35, 8},
{41, 0},
}
_pcsp__validate_utf8 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{11, 40},
{623, 48},
{627, 40},
{628, 32},
{630, 24},
{632, 16},
{634, 8},
{635, 0},
{666, 48},
}
_pcsp__validate_utf8_fast = [][2]uint32{
{1, 0},
{4, 8},
{5, 16},
{247, 24},
{251, 16},
{252, 8},
{253, 0},
{527, 24},
{531, 16},
{532, 8},
{534, 0},
}
_pcsp__value = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{495, 88},
{499, 48},
{500, 40},
{502, 32},
{504, 24},
{506, 16},
{508, 8},
{509, 0},
{1316, 88},
}
_pcsp__vnumber = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{803, 104},
{807, 48},
{808, 40},
{810, 32},
{812, 24},
{814, 16},
{816, 8},
{817, 0},
{1551, 104},
}
_pcsp__atof_eisel_lemire64 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{292, 32},
{293, 24},
{295, 16},
{297, 8},
{298, 0},
{362, 32},
}
_pcsp__atof_native = [][2]uint32{
{1, 0},
{4, 8},
{587, 56},
{591, 8},
{593, 0},
}
_pcsp__decimal_to_f64 = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{1144, 56},
{1148, 48},
{1149, 40},
{1151, 32},
{1153, 24},
{1155, 16},
{1157, 8},
{1158, 0},
{1169, 56},
}
_pcsp__right_shift = [][2]uint32{
{1, 0},
{318, 8},
{319, 0},
{387, 8},
{388, 0},
{396, 8},
{398, 0},
}
_pcsp__left_shift = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{363, 24},
{364, 16},
{366, 8},
{367, 0},
{470, 24},
{471, 16},
{473, 8},
{474, 0},
{486, 24},
}
_pcsp__vsigned = [][2]uint32{
{1, 0},
{4, 8},
{119, 16},
{120, 8},
{121, 0},
{132, 16},
{133, 8},
{134, 0},
{276, 16},
{277, 8},
{278, 0},
{282, 16},
{283, 8},
{284, 0},
{322, 16},
{323, 8},
{324, 0},
{332, 16},
{333, 8},
{335, 0},
}
_pcsp__vstring = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{11, 40},
{105, 56},
{109, 40},
{110, 32},
{112, 24},
{114, 16},
{116, 8},
{118, 0},
}
_pcsp__vunsigned = [][2]uint32{
{1, 0},
{78, 8},
{79, 0},
{90, 8},
{91, 0},
{114, 8},
{115, 0},
{273, 8},
{274, 0},
{312, 8},
{313, 0},
{320, 8},
{322, 0},
}
)
var Funcs = []loader.CFunc{
{"__native_entry__", 0, 67, 0, nil},
{"_f32toa", _entry__f32toa, _size__f32toa, _stack__f32toa, _pcsp__f32toa},
{"_f64toa", _entry__f64toa, _size__f64toa, _stack__f64toa, _pcsp__f64toa},
{"_format_significand", _entry__format_significand, _size__format_significand, _stack__format_significand, _pcsp__format_significand},
{"_format_integer", _entry__format_integer, _size__format_integer, _stack__format_integer, _pcsp__format_integer},
{"_fsm_exec", _entry__fsm_exec, _size__fsm_exec, _stack__fsm_exec, _pcsp__fsm_exec},
{"_advance_string", _entry__advance_string, _size__advance_string, _stack__advance_string, _pcsp__advance_string},
{"_advance_string_default", _entry__advance_string_default, _size__advance_string_default, _stack__advance_string_default, _pcsp__advance_string_default},
{"_do_skip_number", _entry__do_skip_number, _size__do_skip_number, _stack__do_skip_number, _pcsp__do_skip_number},
{"_get_by_path", _entry__get_by_path, _size__get_by_path, _stack__get_by_path, _pcsp__get_by_path},
{"_skip_one_fast", _entry__skip_one_fast, _size__skip_one_fast, _stack__skip_one_fast, _pcsp__skip_one_fast},
{"_html_escape", _entry__html_escape, _size__html_escape, _stack__html_escape, _pcsp__html_escape},
{"_i64toa", _entry__i64toa, _size__i64toa, _stack__i64toa, _pcsp__i64toa},
{"_u64toa", _entry__u64toa, _size__u64toa, _stack__u64toa, _pcsp__u64toa},
{"_lspace", _entry__lspace, _size__lspace, _stack__lspace, _pcsp__lspace},
{"_quote", _entry__quote, _size__quote, _stack__quote, _pcsp__quote},
{"_skip_array", _entry__skip_array, _size__skip_array, _stack__skip_array, _pcsp__skip_array},
{"_skip_number", _entry__skip_number, _size__skip_number, _stack__skip_number, _pcsp__skip_number},
{"_skip_object", _entry__skip_object, _size__skip_object, _stack__skip_object, _pcsp__skip_object},
{"_skip_one", _entry__skip_one, _size__skip_one, _stack__skip_one, _pcsp__skip_one},
{"_unquote", _entry__unquote, _size__unquote, _stack__unquote, _pcsp__unquote},
{"_validate_one", _entry__validate_one, _size__validate_one, _stack__validate_one, _pcsp__validate_one},
{"_validate_utf8", _entry__validate_utf8, _size__validate_utf8, _stack__validate_utf8, _pcsp__validate_utf8},
{"_validate_utf8_fast", _entry__validate_utf8_fast, _size__validate_utf8_fast, _stack__validate_utf8_fast, _pcsp__validate_utf8_fast},
{"_value", _entry__value, _size__value, _stack__value, _pcsp__value},
{"_vnumber", _entry__vnumber, _size__vnumber, _stack__vnumber, _pcsp__vnumber},
{"_atof_eisel_lemire64", _entry__atof_eisel_lemire64, _size__atof_eisel_lemire64, _stack__atof_eisel_lemire64, _pcsp__atof_eisel_lemire64},
{"_atof_native", _entry__atof_native, _size__atof_native, _stack__atof_native, _pcsp__atof_native},
{"_decimal_to_f64", _entry__decimal_to_f64, _size__decimal_to_f64, _stack__decimal_to_f64, _pcsp__decimal_to_f64},
{"_right_shift", _entry__right_shift, _size__right_shift, _stack__right_shift, _pcsp__right_shift},
{"_left_shift", _entry__left_shift, _size__left_shift, _stack__left_shift, _pcsp__left_shift},
{"_vsigned", _entry__vsigned, _size__vsigned, _stack__vsigned, _pcsp__vsigned},
{"_vstring", _entry__vstring, _size__vstring, _stack__vstring, _pcsp__vstring},
{"_vunsigned", _entry__vunsigned, _size__vunsigned, _stack__vunsigned, _pcsp__vunsigned},
}

View File

@@ -19,6 +19,7 @@ package types
import (
`fmt`
`sync`
`unsafe`
)
type ValueType int
@@ -46,15 +47,23 @@ const (
)
const (
// for native.Unquote() flags
B_DOUBLE_UNQUOTE = 0
B_UNICODE_REPLACE = 1
// for native.Value() flags
B_USE_NUMBER = 1
B_VALIDATE_STRING = 5
B_ALLOW_CONTROL = 31
)
const (
F_DOUBLE_UNQUOTE = 1 << B_DOUBLE_UNQUOTE
F_UNICODE_REPLACE = 1 << B_UNICODE_REPLACE
F_USE_NUMBER = 1 << B_USE_NUMBER
F_VALIDATE_STRING = 1 << B_VALIDATE_STRING
F_ALLOW_CONTROL = 1 << B_ALLOW_CONTROL
)
const (
@@ -136,3 +145,18 @@ func FreeStateMachine(fsm *StateMachine) {
stackPool.Put(fsm)
}
const MaxDigitNums = 800
var digitPool = sync.Pool{
New: func() interface{} {
return (*byte)(unsafe.Pointer(&[MaxDigitNums]byte{}))
},
}
func NewDbuf() *byte {
return digitPool.Get().(*byte)
}
func FreeDbuf(p *byte) {
digitPool.Put(p)
}

View File

@@ -1,46 +0,0 @@
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package resolver
import (
_ `encoding/json`
`reflect`
_ `unsafe`
)
type StdField struct {
name string
nameBytes []byte
equalFold func()
nameNonEsc string
nameEscHTML string
tag bool
index []int
typ reflect.Type
omitEmpty bool
quoted bool
encoder func()
}
type StdStructFields struct {
list []StdField
nameIndex map[string]int
}
//go:noescape
//go:linkname typeFields encoding/json.typeFields
func typeFields(_ reflect.Type) StdStructFields

View File

@@ -110,3 +110,15 @@ func StrFrom(p unsafe.Pointer, n int64) (s string) {
(*GoString)(unsafe.Pointer(&s)).Len = int(n)
return
}
// NoEscape hides a pointer from escape analysis. NoEscape is
// the identity function but escape analysis doesn't think the
// output depends on the input. NoEscape is inlined and currently
// compiles down to zero instructions.
// USE CAREFULLY!
//go:nosplit
//goland:noinspection GoVetUnsafePointer
func NoEscape(p unsafe.Pointer) unsafe.Pointer {
x := uintptr(p)
return unsafe.Pointer(x ^ 0)
}

View File

@@ -42,6 +42,13 @@ const (
_SUB_BUCKETSIZE = _BUCKETSIZE / _SUBBUCKETS
)
// Note: This list must match the list in runtime/symtab.go.
const (
FuncFlag_TOPFRAME = 1 << iota
FuncFlag_SPWRITE
FuncFlag_ASM
)
// PCDATA and FUNCDATA table indexes.
//
// See funcdata.h and $GROOT/src/cmd/internal/objabi/funcdata.go.
@@ -142,3 +149,97 @@ func funcNameParts(name string) (string, string, string) {
}
return name[:i], "[...]", name[j+1:]
}
// func name table format:
// nameOff[0] -> namePartA namePartB namePartC \x00
// nameOff[1] -> namePartA namePartB namePartC \x00
// ...
func makeFuncnameTab(funcs []Func) (tab []byte, offs []int32) {
offs = make([]int32, len(funcs))
offset := 1
tab = []byte{0}
for i, f := range funcs {
offs[i] = int32(offset)
a, b, c := funcNameParts(f.Name)
tab = append(tab, a...)
tab = append(tab, b...)
tab = append(tab, c...)
tab = append(tab, 0)
offset += len(a) + len(b) + len(c) + 1
}
return
}
// CU table format:
// cuOffsets[0] -> filetabOffset[0] filetabOffset[1] ... filetabOffset[len(CUs[0].fileNames)-1]
// cuOffsets[1] -> filetabOffset[len(CUs[0].fileNames)] ... filetabOffset[len(CUs[0].fileNames) + len(CUs[1].fileNames)-1]
// ...
//
// file name table format:
// filetabOffset[0] -> CUs[0].fileNames[0] \x00
// ...
// filetabOffset[len(CUs[0]-1)] -> CUs[0].fileNames[len(CUs[0].fileNames)-1] \x00
// ...
// filetabOffset[SUM(CUs,fileNames)-1] -> CUs[len(CU)-1].fileNames[len(CUs[len(CU)-1].fileNames)-1] \x00
func makeFilenametab(cus []compilationUnit) (cutab []uint32, filetab []byte, cuOffsets []uint32) {
cuOffsets = make([]uint32, len(cus))
cuOffset := 0
fileOffset := 0
for i, cu := range cus {
cuOffsets[i] = uint32(cuOffset)
for _, name := range cu.fileNames {
cutab = append(cutab, uint32(fileOffset))
fileOffset += len(name) + 1
filetab = append(filetab, name...)
filetab = append(filetab, 0)
}
cuOffset += len(cu.fileNames)
}
return
}
func writeFuncdata(out *[]byte, funcs []Func) (fstart int, funcdataOffs [][]uint32) {
fstart = len(*out)
*out = append(*out, byte(0))
offs := uint32(1)
funcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
var writer = func(fd encoding.BinaryMarshaler) {
var ab []byte
var err error
if fd != nil {
ab, err = fd.MarshalBinary()
if err != nil {
panic(err)
}
funcdataOffs[i] = append(funcdataOffs[i], offs)
} else {
ab = []byte{0}
funcdataOffs[i] = append(funcdataOffs[i], _INVALID_FUNCDATA_OFFSET)
}
*out = append(*out, ab...)
offs += uint32(len(ab))
}
writer(f.ArgsPointerMaps)
writer(f.LocalsPointerMaps)
writer(f.StackObjects)
writer(f.InlTree)
writer(f.OpenCodedDeferInfo)
writer(f.ArgInfo)
writer(f.ArgLiveInfo)
writer(f.WrapInfo)
}
return
}

View File

@@ -1,549 +0,0 @@
//go:build go1.15 && !go1.16
// +build go1.15,!go1.16
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`encoding`
`os`
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
const (
_Magic uint32 = 0xfffffffa
)
type pcHeader struct {
magic uint32 // 0xFFFFFFF0
pad1, pad2 uint8 // 0,0
minLC uint8 // min instruction size
ptrSize uint8 // size of a ptr in bytes
nfunc int // number of functions in the module
nfiles uint // number of entries in the file tab
funcnameOffset uintptr // offset to the funcnametab variable from pcHeader
cuOffset uintptr // offset to the cutab variable from pcHeader
filetabOffset uintptr // offset to the filetab variable from pcHeader
pctabOffset uintptr // offset to the pctab variable from pcHeader
pclnOffset uintptr // offset to the pclntab variable from pcHeader
}
type moduledata struct {
pcHeader *pcHeader
funcnametab []byte
cutab []uint32
filetab []byte
pctab []byte
pclntable []byte
ftab []funcTab
findfunctab uintptr
minpc, maxpc uintptr // first func address, last func address + last func size
text, etext uintptr // start/end of text, (etext-text) must be greater than MIN_FUNC
noptrdata, enoptrdata uintptr
data, edata uintptr
bss, ebss uintptr
noptrbss, enoptrbss uintptr
end, gcdata, gcbss uintptr
types, etypes uintptr
textsectmap []textSection // see runtime/symtab.go: textAddr()
typelinks []int32 // offsets from types
itablinks []*rt.GoItab
ptab []ptabEntry
pluginpath string
pkghashes []modulehash
modulename string
modulehashes []modulehash
hasmain uint8 // 1 if module contains the main function, 0 otherwise
gcdatamask, gcbssmask bitVector
typemap map[int32]*rt.GoType // offset to *_rtype in previous module
bad bool // module failed to load and should be ignored
next *moduledata
}
type _func struct {
entry uintptr // start pc, as offset from moduledata.text/pcHeader.textStart
nameOff int32 // function name, as index into moduledata.funcnametab.
args int32 // in/out args size
deferreturn uint32 // offset of start of a deferreturn call instruction from entry, if any.
pcsp uint32
pcfile uint32
pcln uint32
npcdata uint32
cuOffset uint32 // runtime.cutab offset of this function's CU
funcID uint8 // set for certain special runtime functions
_ [2]byte // pad
nfuncdata uint8 //
// The end of the struct is followed immediately by two variable-length
// arrays that reference the pcdata and funcdata locations for this
// function.
// pcdata contains the offset into moduledata.pctab for the start of
// that index's table. e.g.,
// &moduledata.pctab[_func.pcdata[_PCDATA_UnsafePoint]] is the start of
// the unsafe point table.
//
// An offset of 0 indicates that there is no table.
//
// pcdata [npcdata]uint32
// funcdata contains the offset past moduledata.gofunc which contains a
// pointer to that index's funcdata. e.g.,
// *(moduledata.gofunc + _func.funcdata[_FUNCDATA_ArgsPointerMaps]) is
// the argument pointer map.
//
// An offset of ^uint32(0) indicates that there is no entry.
//
// funcdata [nfuncdata]uint32
}
type funcTab struct {
entry uintptr
funcoff uintptr
}
type bitVector struct {
n int32 // # of bits
bytedata *uint8
}
type ptabEntry struct {
name int32
typ int32
}
type textSection struct {
vaddr uintptr // prelinked section vaddr
end uintptr // vaddr + section length
baseaddr uintptr // relocated section address
}
type modulehash struct {
modulename string
linktimehash string
runtimehash *string
}
// findfuncbucket is an array of these structures.
// Each bucket represents 4096 bytes of the text segment.
// Each subbucket represents 256 bytes of the text segment.
// To find a function given a pc, locate the bucket and subbucket for
// that pc. Add together the idx and subbucket value to obtain a
// function index. Then scan the functab array starting at that
// index to find the target function.
// This table uses 20 bytes for every 4096 bytes of code, or ~0.5% overhead.
type findfuncbucket struct {
idx uint32
_SUBBUCKETS [16]byte
}
type compilationUnit struct {
fileNames []string
}
// func name table format:
// nameOff[0] -> namePartA namePartB namePartC \x00
// nameOff[1] -> namePartA namePartB namePartC \x00
// ...
func makeFuncnameTab(funcs []Func) (tab []byte, offs []int32) {
offs = make([]int32, len(funcs))
offset := 0
for i, f := range funcs {
offs[i] = int32(offset)
a, b, c := funcNameParts(f.Name)
tab = append(tab, a...)
tab = append(tab, b...)
tab = append(tab, c...)
tab = append(tab, 0)
offset += len(a) + len(b) + len(c) + 1
}
return
}
// CU table format:
// cuOffsets[0] -> filetabOffset[0] filetabOffset[1] ... filetabOffset[len(CUs[0].fileNames)-1]
// cuOffsets[1] -> filetabOffset[len(CUs[0].fileNames)] ... filetabOffset[len(CUs[0].fileNames) + len(CUs[1].fileNames)-1]
// ...
//
// file name table format:
// filetabOffset[0] -> CUs[0].fileNames[0] \x00
// ...
// filetabOffset[len(CUs[0]-1)] -> CUs[0].fileNames[len(CUs[0].fileNames)-1] \x00
// ...
// filetabOffset[SUM(CUs,fileNames)-1] -> CUs[len(CU)-1].fileNames[len(CUs[len(CU)-1].fileNames)-1] \x00
func makeFilenametab(cus []compilationUnit) (cutab []uint32, filetab []byte, cuOffsets []uint32) {
cuOffsets = make([]uint32, len(cus))
cuOffset := 0
fileOffset := 0
for i, cu := range cus {
cuOffsets[i] = uint32(cuOffset)
for _, name := range cu.fileNames {
cutab = append(cutab, uint32(fileOffset))
fileOffset += len(name) + 1
filetab = append(filetab, name...)
filetab = append(filetab, 0)
}
cuOffset += len(cu.fileNames)
}
return
}
func writeFuncdata(out *[]byte, funcs []Func) (fstart int, funcdataOffs [][]uint32) {
fstart = len(*out)
*out = append(*out, byte(0))
offs := uint32(1)
funcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
var writer = func(fd encoding.BinaryMarshaler) {
var ab []byte
var err error
if fd != nil {
ab, err = fd.MarshalBinary()
if err != nil {
panic(err)
}
funcdataOffs[i] = append(funcdataOffs[i], offs)
} else {
ab = []byte{0}
funcdataOffs[i] = append(funcdataOffs[i], _INVALID_FUNCDATA_OFFSET)
}
*out = append(*out, ab...)
offs += uint32(len(ab))
}
writer(f.ArgsPointerMaps)
writer(f.LocalsPointerMaps)
writer(f.StackObjects)
writer(f.InlTree)
writer(f.OpenCodedDeferInfo)
writer(f.ArgInfo)
writer(f.ArgLiveInfo)
writer(f.WrapInfo)
}
return
}
func makeFtab(funcs []_func, lastFuncSize uint32) (ftab []funcTab, pclntabSize int64, startLocations []uint32) {
// Allocate space for the pc->func table. This structure consists of a pc offset
// and an offset to the func structure. After that, we have a single pc
// value that marks the end of the last function in the binary.
pclntabSize = int64(len(funcs)*2*int(_PtrSize) + int(_PtrSize))
startLocations = make([]uint32, len(funcs))
for i, f := range funcs {
pclntabSize = rnd(pclntabSize, int64(_PtrSize))
//writePCToFunc
startLocations[i] = uint32(pclntabSize)
pclntabSize += int64(uint8(_FUNC_SIZE) + f.nfuncdata*_PtrSize + uint8(f.npcdata)*4)
}
ftab = make([]funcTab, 0, len(funcs)+1)
// write a map of pc->func info offsets
for i, f := range funcs {
ftab = append(ftab, funcTab{uintptr(f.entry), uintptr(startLocations[i])})
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
ftab = append(ftab, funcTab{lastFunc.entry + uintptr(lastFuncSize), 0})
return
}
// Pcln table format: [...]funcTab + [...]_Func
func makePclntable(size int64, startLocations []uint32, funcs []_func, lastFuncSize uint32, pcdataOffs [][]uint32, funcdataAddr uintptr, funcdataOffs [][]uint32) (pclntab []byte) {
pclntab = make([]byte, size, size)
// write a map of pc->func info offsets
offs := 0
for i, f := range funcs {
byteOrder.PutUint64(pclntab[offs:offs+8], uint64(f.entry))
byteOrder.PutUint64(pclntab[offs+8:offs+16], uint64(startLocations[i]))
offs += 16
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
byteOrder.PutUint64(pclntab[offs:offs+8], uint64(lastFunc.entry)+uint64(lastFuncSize))
offs += 8
// write func info table
for i, f := range funcs {
off := startLocations[i]
// write _func structure to pclntab
byteOrder.PutUint64(pclntab[off:off+8], uint64(f.entry))
off += 8
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.nameOff))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.args))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.deferreturn))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.pcsp))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.pcfile))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.pcln))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.npcdata))
off += 4
byteOrder.PutUint32(pclntab[off:off+4], uint32(f.cuOffset))
off += 4
pclntab[off] = f.funcID
// NOTICE: _[2]byte alignment
off += 3
pclntab[off] = f.nfuncdata
off += 1
// NOTICE: _func.pcdata always starts from PcUnsafePoint, which is index 3
for j := 3; j < len(pcdataOffs[i]); j++ {
byteOrder.PutUint32(pclntab[off:off+4], uint32(pcdataOffs[i][j]))
off += 4
}
off = uint32(rnd(int64(off), int64(_PtrSize)))
// funcdata refs as offsets from gofunc
for _, funcdata := range funcdataOffs[i] {
if funcdata == _INVALID_FUNCDATA_OFFSET {
byteOrder.PutUint64(pclntab[off:off+8], 0)
} else {
byteOrder.PutUint64(pclntab[off:off+8], uint64(funcdataAddr)+uint64(funcdata))
}
off += 8
}
}
return
}
// findfunc table used to map pc to belonging func,
// returns the index in the func table.
//
// All text section are divided into buckets sized _BUCKETSIZE(4K):
// every bucket is divided into _SUBBUCKETS sized _SUB_BUCKETSIZE(64),
// and it has a base idx to plus the offset stored in jth subbucket.
// see findfunc() in runtime/symtab.go
func writeFindfunctab(out *[]byte, ftab []funcTab) (start int) {
start = len(*out)
max := ftab[len(ftab)-1].entry
min := ftab[0].entry
nbuckets := (max - min + _BUCKETSIZE - 1) / _BUCKETSIZE
n := (max - min + _SUB_BUCKETSIZE - 1) / _SUB_BUCKETSIZE
tab := make([]findfuncbucket, 0, nbuckets)
var s, e = 0, 0
for i := 0; i<int(nbuckets); i++ {
var pc = min + uintptr((i+1)*_BUCKETSIZE)
// find the end func of the bucket
for ; e < len(ftab)-1 && ftab[e+1].entry <= pc; e++ {}
// store the start func of the bucket
var fb = findfuncbucket{idx: uint32(s)}
for j := 0; j<_SUBBUCKETS && (i*_SUBBUCKETS+j)<int(n); j++ {
pc = min + uintptr(i*_BUCKETSIZE) + uintptr((j+1)*_SUB_BUCKETSIZE)
var ss = s
// find the end func of the subbucket
for ; ss < len(ftab)-1 && ftab[ss+1].entry <= pc; ss++ {}
// store the start func of the subbucket
fb._SUBBUCKETS[j] = byte(uint32(s) - fb.idx)
s = ss
}
s = e
tab = append(tab, fb)
}
// write findfuncbucket
if len(tab) > 0 {
size := int(unsafe.Sizeof(findfuncbucket{}))*len(tab)
*out = append(*out, rt.BytesFrom(unsafe.Pointer(&tab[0]), size, size)...)
}
return
}
func makeModuledata(name string, filenames []string, funcs []Func, text []byte) (mod *moduledata) {
mod = new(moduledata)
mod.modulename = name
// make filename table
cu := make([]string, 0, len(filenames))
for _, f := range filenames {
cu = append(cu, f)
}
cutab, filetab, cuOffs := makeFilenametab([]compilationUnit{{cu}})
mod.cutab = cutab
mod.filetab = filetab
// make funcname table
funcnametab, nameOffs := makeFuncnameTab(funcs)
mod.funcnametab = funcnametab
// mmap() text and funcdata segements
p := os.Getpagesize()
size := int(rnd(int64(len(text)), int64(p)))
addr := mmap(size)
// copy the machine code
s := rt.BytesFrom(unsafe.Pointer(addr), len(text), size)
copy(s, text)
// make it executable
mprotect(addr, size)
// make pcdata table
// NOTICE: _func only use offset to index pcdata, thus no need mmap() pcdata
pctab, pcdataOffs, _funcs := makePctab(funcs, addr, cuOffs, nameOffs)
mod.pctab = pctab
// write func data
// NOTICE: _func use mod.gofunc+offset to directly point funcdata, thus need cache funcdata
// TODO: estimate accurate capacity
cache := make([]byte, 0, len(funcs)*int(_PtrSize))
fstart, funcdataOffs := writeFuncdata(&cache, funcs)
// make pc->func (binary search) func table
lastFuncsize := funcs[len(funcs)-1].TextSize
ftab, pclntSize, startLocations := makeFtab(_funcs, lastFuncsize)
mod.ftab = ftab
// write pc->func (modmap) findfunc table
ffstart := writeFindfunctab(&cache, ftab)
// cache funcdata and findfuncbucket
moduleCache.Lock()
moduleCache.m[mod] = cache
moduleCache.Unlock()
mod.findfunctab = uintptr(rt.IndexByte(cache, ffstart))
funcdataAddr := uintptr(rt.IndexByte(cache, fstart))
// make pclnt table
pclntab := makePclntable(pclntSize, startLocations, _funcs, lastFuncsize, pcdataOffs, funcdataAddr, funcdataOffs)
mod.pclntable = pclntab
// assign addresses
mod.text = addr
mod.etext = addr + uintptr(size)
mod.minpc = addr
mod.maxpc = addr + uintptr(len(text))
// make pc header
mod.pcHeader = &pcHeader {
magic : _Magic,
minLC : _MinLC,
ptrSize : _PtrSize,
nfunc : len(funcs),
nfiles: uint(len(cu)),
funcnameOffset: getOffsetOf(moduledata{}, "funcnametab"),
cuOffset: getOffsetOf(moduledata{}, "cutab"),
filetabOffset: getOffsetOf(moduledata{}, "filetab"),
pctabOffset: getOffsetOf(moduledata{}, "pctab"),
pclnOffset: getOffsetOf(moduledata{}, "pclntable"),
}
// sepecial case: gcdata and gcbss must by non-empty
mod.gcdata = uintptr(unsafe.Pointer(&emptyByte))
mod.gcbss = uintptr(unsafe.Pointer(&emptyByte))
return
}
// makePctab generates pcdelta->valuedelta tables for functions,
// and returns the table and the entry offset of every kind pcdata in the table.
func makePctab(funcs []Func, addr uintptr, cuOffset []uint32, nameOffset []int32) (pctab []byte, pcdataOffs [][]uint32, _funcs []_func) {
_funcs = make([]_func, len(funcs))
// Pctab offsets of 0 are considered invalid in the runtime. We respect
// that by just padding a single byte at the beginning of runtime.pctab,
// that way no real offsets can be zero.
pctab = make([]byte, 1, 12*len(funcs)+1)
pcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
_f := &_funcs[i]
var writer = func(pc *Pcdata) {
var ab []byte
var err error
if pc != nil {
ab, err = pc.MarshalBinary()
if err != nil {
panic(err)
}
pcdataOffs[i] = append(pcdataOffs[i], uint32(len(pctab)))
} else {
ab = []byte{0}
pcdataOffs[i] = append(pcdataOffs[i], _PCDATA_INVALID_OFFSET)
}
pctab = append(pctab, ab...)
}
if f.Pcsp != nil {
_f.pcsp = uint32(len(pctab))
}
writer(f.Pcsp)
if f.Pcfile != nil {
_f.pcfile = uint32(len(pctab))
}
writer(f.Pcfile)
if f.Pcline != nil {
_f.pcln = uint32(len(pctab))
}
writer(f.Pcline)
writer(f.PcUnsafePoint)
writer(f.PcStackMapIndex)
writer(f.PcInlTreeIndex)
writer(f.PcArgLiveIndex)
_f.entry = addr + uintptr(f.EntryOff)
_f.nameOff = nameOffset[i]
_f.args = f.ArgsSize
_f.deferreturn = f.DeferReturn
// NOTICE: _func.pcdata is always as [PCDATA_UnsafePoint(0) : PCDATA_ArgLiveIndex(3)]
_f.npcdata = uint32(_N_PCDATA)
_f.cuOffset = cuOffset[i]
_f.funcID = f.ID
_f.nfuncdata = uint8(_N_FUNCDATA)
}
return
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argptrs uintptr, localptrs uintptr) {}

View File

@@ -20,9 +20,9 @@
package loader
import (
`encoding`
`os`
`unsafe`
`sort`
`github.com/bytedance/sonic/internal/rt`
)
@@ -171,99 +171,7 @@ type compilationUnit struct {
fileNames []string
}
// func name table format:
// nameOff[0] -> namePartA namePartB namePartC \x00
// nameOff[1] -> namePartA namePartB namePartC \x00
// ...
func makeFuncnameTab(funcs []Func) (tab []byte, offs []int32) {
offs = make([]int32, len(funcs))
offset := 0
for i, f := range funcs {
offs[i] = int32(offset)
a, b, c := funcNameParts(f.Name)
tab = append(tab, a...)
tab = append(tab, b...)
tab = append(tab, c...)
tab = append(tab, 0)
offset += len(a) + len(b) + len(c) + 1
}
return
}
// CU table format:
// cuOffsets[0] -> filetabOffset[0] filetabOffset[1] ... filetabOffset[len(CUs[0].fileNames)-1]
// cuOffsets[1] -> filetabOffset[len(CUs[0].fileNames)] ... filetabOffset[len(CUs[0].fileNames) + len(CUs[1].fileNames)-1]
// ...
//
// file name table format:
// filetabOffset[0] -> CUs[0].fileNames[0] \x00
// ...
// filetabOffset[len(CUs[0]-1)] -> CUs[0].fileNames[len(CUs[0].fileNames)-1] \x00
// ...
// filetabOffset[SUM(CUs,fileNames)-1] -> CUs[len(CU)-1].fileNames[len(CUs[len(CU)-1].fileNames)-1] \x00
func makeFilenametab(cus []compilationUnit) (cutab []uint32, filetab []byte, cuOffsets []uint32) {
cuOffsets = make([]uint32, len(cus))
cuOffset := 0
fileOffset := 0
for i, cu := range cus {
cuOffsets[i] = uint32(cuOffset)
for _, name := range cu.fileNames {
cutab = append(cutab, uint32(fileOffset))
fileOffset += len(name) + 1
filetab = append(filetab, name...)
filetab = append(filetab, 0)
}
cuOffset += len(cu.fileNames)
}
return
}
func writeFuncdata(out *[]byte, funcs []Func) (fstart int, funcdataOffs [][]uint32) {
fstart = len(*out)
*out = append(*out, byte(0))
offs := uint32(1)
funcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
var writer = func(fd encoding.BinaryMarshaler) {
var ab []byte
var err error
if fd != nil {
ab, err = fd.MarshalBinary()
if err != nil {
panic(err)
}
funcdataOffs[i] = append(funcdataOffs[i], offs)
} else {
ab = []byte{0}
funcdataOffs[i] = append(funcdataOffs[i], _INVALID_FUNCDATA_OFFSET)
}
*out = append(*out, ab...)
offs += uint32(len(ab))
}
writer(f.ArgsPointerMaps)
writer(f.LocalsPointerMaps)
writer(f.StackObjects)
writer(f.InlTree)
writer(f.OpenCodedDeferInfo)
writer(f.ArgInfo)
writer(f.ArgLiveInfo)
writer(f.WrapInfo)
}
return
}
func makeFtab(funcs []_func, lastFuncSize uint32) (ftab []funcTab, pclntabSize int64, startLocations []uint32) {
func makeFtab(funcs []_func, maxpc uintptr) (ftab []funcTab, pclntabSize int64, startLocations []uint32) {
// Allocate space for the pc->func table. This structure consists of a pc offset
// and an offset to the func structure. After that, we have a single pc
// value that marks the end of the last function in the binary.
@@ -283,14 +191,13 @@ func makeFtab(funcs []_func, lastFuncSize uint32) (ftab []funcTab, pclntabSize i
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
ftab = append(ftab, funcTab{lastFunc.entry + uintptr(lastFuncSize), 0})
ftab = append(ftab, funcTab{maxpc, 0})
return
}
// Pcln table format: [...]funcTab + [...]_Func
func makePclntable(size int64, startLocations []uint32, funcs []_func, lastFuncSize uint32, pcdataOffs [][]uint32, funcdataAddr uintptr, funcdataOffs [][]uint32) (pclntab []byte) {
func makePclntable(size int64, startLocations []uint32, funcs []_func, maxpc uintptr, pcdataOffs [][]uint32, funcdataAddr uintptr, funcdataOffs [][]uint32) (pclntab []byte) {
pclntab = make([]byte, size, size)
// write a map of pc->func info offsets
@@ -301,8 +208,7 @@ func makePclntable(size int64, startLocations []uint32, funcs []_func, lastFuncS
offs += 16
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
byteOrder.PutUint64(pclntab[offs:offs+8], uint64(lastFunc.entry)+uint64(lastFuncSize))
byteOrder.PutUint64(pclntab[offs:offs+8], uint64(maxpc))
offs += 8
// write func info table
@@ -374,21 +280,22 @@ func writeFindfunctab(out *[]byte, ftab []funcTab) (start int) {
tab := make([]findfuncbucket, 0, nbuckets)
var s, e = 0, 0
for i := 0; i<int(nbuckets); i++ {
var pc = min + uintptr((i+1)*_BUCKETSIZE)
// find the end func of the bucket
for ; e < len(ftab)-1 && ftab[e+1].entry <= pc; e++ {}
// store the start func of the bucket
var fb = findfuncbucket{idx: uint32(s)}
// find the last e-th func of the bucket
var pc = min + uintptr((i+1)*_BUCKETSIZE)
for ; e < len(ftab)-1 && ftab[e+1].entry <= pc; e++ {}
for j := 0; j<_SUBBUCKETS && (i*_SUBBUCKETS+j)<int(n); j++ {
pc = min + uintptr(i*_BUCKETSIZE) + uintptr((j+1)*_SUB_BUCKETSIZE)
var ss = s
// find the end func of the subbucket
for ; ss < len(ftab)-1 && ftab[ss+1].entry <= pc; ss++ {}
// store the start func of the subbucket
fb._SUBBUCKETS[j] = byte(uint32(s) - fb.idx)
s = ss
// find the s-th end func of the subbucket
pc = min + uintptr(i*_BUCKETSIZE) + uintptr((j+1)*_SUB_BUCKETSIZE)
for ; s < len(ftab)-1 && ftab[s+1].entry <= pc; s++ {}
}
s = e
tab = append(tab, fb)
}
@@ -401,15 +308,20 @@ func writeFindfunctab(out *[]byte, ftab []funcTab) (start int) {
return
}
func makeModuledata(name string, filenames []string, funcs []Func, text []byte) (mod *moduledata) {
func makeModuledata(name string, filenames []string, funcsp *[]Func, text []byte) (mod *moduledata) {
mod = new(moduledata)
mod.modulename = name
// sort funcs by entry
funcs := *funcsp
sort.Slice(funcs, func(i, j int) bool {
return funcs[i].EntryOff < funcs[j].EntryOff
})
*funcsp = funcs
// make filename table
cu := make([]string, 0, len(filenames))
for _, f := range filenames {
cu = append(cu, f)
}
cu = append(cu, filenames...)
cutab, filetab, cuOffs := makeFilenametab([]compilationUnit{{cu}})
mod.cutab = cutab
mod.filetab = filetab
@@ -428,9 +340,16 @@ func makeModuledata(name string, filenames []string, funcs []Func, text []byte)
// make it executable
mprotect(addr, size)
// assign addresses
mod.text = addr
mod.etext = addr + uintptr(size)
mod.minpc = addr
mod.maxpc = addr + uintptr(len(text))
// make pcdata table
// NOTICE: _func only use offset to index pcdata, thus no need mmap() pcdata
pctab, pcdataOffs, _funcs := makePctab(funcs, addr, cuOffs, nameOffs)
cuOff := cuOffs[0]
pctab, pcdataOffs, _funcs := makePctab(funcs, addr, cuOff, nameOffs)
mod.pctab = pctab
// write func data
@@ -440,8 +359,7 @@ func makeModuledata(name string, filenames []string, funcs []Func, text []byte)
fstart, funcdataOffs := writeFuncdata(&cache, funcs)
// make pc->func (binary search) func table
lastFuncsize := funcs[len(funcs)-1].TextSize
ftab, pclntSize, startLocations := makeFtab(_funcs, lastFuncsize)
ftab, pclntSize, startLocations := makeFtab(_funcs, mod.maxpc)
mod.ftab = ftab
// write pc->func (modmap) findfunc table
@@ -455,15 +373,9 @@ func makeModuledata(name string, filenames []string, funcs []Func, text []byte)
funcdataAddr := uintptr(rt.IndexByte(cache, fstart))
// make pclnt table
pclntab := makePclntable(pclntSize, startLocations, _funcs, lastFuncsize, pcdataOffs, funcdataAddr, funcdataOffs)
pclntab := makePclntable(pclntSize, startLocations, _funcs, mod.maxpc, pcdataOffs, funcdataAddr, funcdataOffs)
mod.pclntable = pclntab
// assign addresses
mod.text = addr
mod.etext = addr + uintptr(size)
mod.minpc = addr
mod.maxpc = addr + uintptr(len(text))
// make pc header
mod.pcHeader = &pcHeader {
magic : _Magic,
@@ -487,7 +399,7 @@ func makeModuledata(name string, filenames []string, funcs []Func, text []byte)
// makePctab generates pcdelta->valuedelta tables for functions,
// and returns the table and the entry offset of every kind pcdata in the table.
func makePctab(funcs []Func, addr uintptr, cuOffset []uint32, nameOffset []int32) (pctab []byte, pcdataOffs [][]uint32, _funcs []_func) {
func makePctab(funcs []Func, addr uintptr, cuOffset uint32, nameOffset []int32) (pctab []byte, pcdataOffs [][]uint32, _funcs []_func) {
_funcs = make([]_func, len(funcs))
// Pctab offsets of 0 are considered invalid in the runtime. We respect
@@ -538,7 +450,7 @@ func makePctab(funcs []Func, addr uintptr, cuOffset []uint32, nameOffset []int32
_f.deferreturn = f.DeferReturn
// NOTICE: _func.pcdata is always as [PCDATA_UnsafePoint(0) : PCDATA_ArgLiveIndex(3)]
_f.npcdata = uint32(_N_PCDATA)
_f.cuOffset = cuOffset[i]
_f.cuOffset = cuOffset
_f.funcID = f.ID
_f.nfuncdata = uint8(_N_FUNCDATA)
}

View File

@@ -1,4 +1,5 @@
// go:build go1.18 && !go1.20
//go:build go1.18 && !go1.20
// +build go1.18,!go1.20
/*
@@ -20,10 +21,6 @@
package loader
import (
`encoding`
`os`
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
@@ -31,21 +28,6 @@ const (
_Magic uint32 = 0xfffffff0
)
type pcHeader struct {
magic uint32 // 0xFFFFFFF0
pad1, pad2 uint8 // 0,0
minLC uint8 // min instruction size
ptrSize uint8 // size of a ptr in bytes
nfunc int // number of functions in the module
nfiles uint // number of entries in the file tab
textStart uintptr // base for function entry PC offsets in this module, equal to moduledata.text
funcnameOffset uintptr // offset to the funcnametab variable from pcHeader
cuOffset uintptr // offset to the cutab variable from pcHeader
filetabOffset uintptr // offset to the filetab variable from pcHeader
pctabOffset uintptr // offset to the pctab variable from pcHeader
pclnOffset uintptr // offset to the pclntab variable from pcHeader
}
type moduledata struct {
pcHeader *pcHeader
funcnametab []byte
@@ -129,413 +111,3 @@ type _func struct {
//
// funcdata [nfuncdata]uint32
}
type funcTab struct {
entry uint32
funcoff uint32
}
type bitVector struct {
n int32 // # of bits
bytedata *uint8
}
type ptabEntry struct {
name int32
typ int32
}
type textSection struct {
vaddr uintptr // prelinked section vaddr
end uintptr // vaddr + section length
baseaddr uintptr // relocated section address
}
type modulehash struct {
modulename string
linktimehash string
runtimehash *string
}
// findfuncbucket is an array of these structures.
// Each bucket represents 4096 bytes of the text segment.
// Each subbucket represents 256 bytes of the text segment.
// To find a function given a pc, locate the bucket and subbucket for
// that pc. Add together the idx and subbucket value to obtain a
// function index. Then scan the functab array starting at that
// index to find the target function.
// This table uses 20 bytes for every 4096 bytes of code, or ~0.5% overhead.
type findfuncbucket struct {
idx uint32
_SUBBUCKETS [16]byte
}
// func name table format:
// nameOff[0] -> namePartA namePartB namePartC \x00
// nameOff[1] -> namePartA namePartB namePartC \x00
// ...
func makeFuncnameTab(funcs []Func) (tab []byte, offs []int32) {
offs = make([]int32, len(funcs))
offset := 0
for i, f := range funcs {
offs[i] = int32(offset)
a, b, c := funcNameParts(f.Name)
tab = append(tab, a...)
tab = append(tab, b...)
tab = append(tab, c...)
tab = append(tab, 0)
offset += len(a) + len(b) + len(c) + 1
}
return
}
type compilationUnit struct {
fileNames []string
}
// CU table format:
// cuOffsets[0] -> filetabOffset[0] filetabOffset[1] ... filetabOffset[len(CUs[0].fileNames)-1]
// cuOffsets[1] -> filetabOffset[len(CUs[0].fileNames)] ... filetabOffset[len(CUs[0].fileNames) + len(CUs[1].fileNames)-1]
// ...
//
// file name table format:
// filetabOffset[0] -> CUs[0].fileNames[0] \x00
// ...
// filetabOffset[len(CUs[0]-1)] -> CUs[0].fileNames[len(CUs[0].fileNames)-1] \x00
// ...
// filetabOffset[SUM(CUs,fileNames)-1] -> CUs[len(CU)-1].fileNames[len(CUs[len(CU)-1].fileNames)-1] \x00
func makeFilenametab(cus []compilationUnit) (cutab []uint32, filetab []byte, cuOffsets []uint32) {
cuOffsets = make([]uint32, len(cus))
cuOffset := 0
fileOffset := 0
for i, cu := range cus {
cuOffsets[i] = uint32(cuOffset)
for _, name := range cu.fileNames {
cutab = append(cutab, uint32(fileOffset))
fileOffset += len(name) + 1
filetab = append(filetab, name...)
filetab = append(filetab, 0)
}
cuOffset += len(cu.fileNames)
}
return
}
func writeFuncdata(out *[]byte, funcs []Func) (fstart int, funcdataOffs [][]uint32) {
fstart = len(*out)
*out = append(*out, byte(0))
offs := uint32(1)
funcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
var writer = func(fd encoding.BinaryMarshaler) {
var ab []byte
var err error
if fd != nil {
ab, err = fd.MarshalBinary()
if err != nil {
panic(err)
}
funcdataOffs[i] = append(funcdataOffs[i], offs)
} else {
ab = []byte{0}
funcdataOffs[i] = append(funcdataOffs[i], _INVALID_FUNCDATA_OFFSET)
}
*out = append(*out, ab...)
offs += uint32(len(ab))
}
writer(f.ArgsPointerMaps)
writer(f.LocalsPointerMaps)
writer(f.StackObjects)
writer(f.InlTree)
writer(f.OpenCodedDeferInfo)
writer(f.ArgInfo)
writer(f.ArgLiveInfo)
writer(f.WrapInfo)
}
return
}
func makeFtab(funcs []_func, lastFuncSize uint32) (ftab []funcTab) {
// Allocate space for the pc->func table. This structure consists of a pc offset
// and an offset to the func structure. After that, we have a single pc
// value that marks the end of the last function in the binary.
var size int64 = int64(len(funcs)*2*4 + 4)
var startLocations = make([]uint32, len(funcs))
for i, f := range funcs {
size = rnd(size, int64(_PtrSize))
//writePCToFunc
startLocations[i] = uint32(size)
size += int64(uint8(_FUNC_SIZE)+f.nfuncdata*4+uint8(f.npcdata)*4)
}
ftab = make([]funcTab, 0, len(funcs)+1)
// write a map of pc->func info offsets
for i, f := range funcs {
ftab = append(ftab, funcTab{uint32(f.entryOff), uint32(startLocations[i])})
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
ftab = append(ftab, funcTab{uint32(lastFunc.entryOff + lastFuncSize), 0})
return
}
// Pcln table format: [...]funcTab + [...]_Func
func makePclntable(funcs []_func, lastFuncSize uint32, pcdataOffs [][]uint32, funcdataOffs [][]uint32) (pclntab []byte) {
// Allocate space for the pc->func table. This structure consists of a pc offset
// and an offset to the func structure. After that, we have a single pc
// value that marks the end of the last function in the binary.
var size int64 = int64(len(funcs)*2*4 + 4)
var startLocations = make([]uint32, len(funcs))
for i := range funcs {
size = rnd(size, int64(_PtrSize))
//writePCToFunc
startLocations[i] = uint32(size)
size += int64(int(_FUNC_SIZE)+len(funcdataOffs[i])*4+len(pcdataOffs[i])*4)
}
pclntab = make([]byte, size, size)
// write a map of pc->func info offsets
offs := 0
for i, f := range funcs {
byteOrder.PutUint32(pclntab[offs:offs+4], uint32(f.entryOff))
byteOrder.PutUint32(pclntab[offs+4:offs+8], uint32(startLocations[i]))
offs += 8
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
byteOrder.PutUint32(pclntab[offs:offs+4], uint32(lastFunc.entryOff+lastFuncSize))
// write func info table
for i, f := range funcs {
off := startLocations[i]
// write _func structure to pclntab
fb := rt.BytesFrom(unsafe.Pointer(&f), int(_FUNC_SIZE), int(_FUNC_SIZE))
copy(pclntab[off:off+uint32(_FUNC_SIZE)], fb)
off += uint32(_FUNC_SIZE)
// NOTICE: _func.pcdata always starts from PcUnsafePoint, which is index 3
for j := 3; j < len(pcdataOffs[i]); j++ {
byteOrder.PutUint32(pclntab[off:off+4], uint32(pcdataOffs[i][j]))
off += 4
}
// funcdata refs as offsets from gofunc
for _, funcdata := range funcdataOffs[i] {
byteOrder.PutUint32(pclntab[off:off+4], uint32(funcdata))
off += 4
}
}
return
}
// findfunc table used to map pc to belonging func,
// returns the index in the func table.
//
// All text section are divided into buckets sized _BUCKETSIZE(4K):
// every bucket is divided into _SUBBUCKETS sized _SUB_BUCKETSIZE(64),
// and it has a base idx to plus the offset stored in jth subbucket.
// see findfunc() in runtime/symtab.go
func writeFindfunctab(out *[]byte, ftab []funcTab) (start int) {
start = len(*out)
max := ftab[len(ftab)-1].entry
min := ftab[0].entry
nbuckets := (max - min + _BUCKETSIZE - 1) / _BUCKETSIZE
n := (max - min + _SUB_BUCKETSIZE - 1) / _SUB_BUCKETSIZE
tab := make([]findfuncbucket, 0, nbuckets)
var s, e = 0, 0
for i := 0; i<int(nbuckets); i++ {
var pc = min + uint32((i+1)*_BUCKETSIZE)
// find the end func of the bucket
for ; e < len(ftab)-1 && ftab[e+1].entry <= pc; e++ {}
// store the start func of the bucket
var fb = findfuncbucket{idx: uint32(s)}
for j := 0; j<_SUBBUCKETS && (i*_SUBBUCKETS+j)<int(n); j++ {
pc = min + uint32(i*_BUCKETSIZE) + uint32((j+1)*_SUB_BUCKETSIZE)
var ss = s
// find the end func of the subbucket
for ; ss < len(ftab)-1 && ftab[ss+1].entry <= pc; ss++ {}
// store the start func of the subbucket
fb._SUBBUCKETS[j] = byte(uint32(s) - fb.idx)
s = ss
}
s = e
tab = append(tab, fb)
}
// write findfuncbucket
if len(tab) > 0 {
size := int(unsafe.Sizeof(findfuncbucket{}))*len(tab)
*out = append(*out, rt.BytesFrom(unsafe.Pointer(&tab[0]), size, size)...)
}
return
}
func makeModuledata(name string, filenames []string, funcs []Func, text []byte) (mod *moduledata) {
mod = new(moduledata)
mod.modulename = name
// make filename table
cu := make([]string, 0, len(filenames))
for _, f := range filenames {
cu = append(cu, f)
}
cutab, filetab, cuOffs := makeFilenametab([]compilationUnit{{cu}})
mod.cutab = cutab
mod.filetab = filetab
// make funcname table
funcnametab, nameOffs := makeFuncnameTab(funcs)
mod.funcnametab = funcnametab
// make pcdata table
// NOTICE: _func only use offset to index pcdata, thus no need mmap() pcdata
pctab, pcdataOffs, _funcs := makePctab(funcs, cuOffs, nameOffs)
mod.pctab = pctab
// write func data
// NOTICE: _func use mod.gofunc+offset to directly point funcdata, thus need cache funcdata
// TODO: estimate accurate capacity
cache := make([]byte, 0, len(funcs)*int(_PtrSize))
fstart, funcdataOffs := writeFuncdata(&cache, funcs)
// make pc->func (binary search) func table
lastFuncsize := funcs[len(funcs)-1].TextSize
ftab := makeFtab(_funcs, lastFuncsize)
mod.ftab = ftab
// write pc->func (modmap) findfunc table
ffstart := writeFindfunctab(&cache, ftab)
// make pclnt table
pclntab := makePclntable(_funcs, lastFuncsize, pcdataOffs, funcdataOffs)
mod.pclntable = pclntab
// mmap() text and funcdata segements
p := os.Getpagesize()
size := int(rnd(int64(len(text)), int64(p)))
addr := mmap(size)
// copy the machine code
s := rt.BytesFrom(unsafe.Pointer(addr), len(text), size)
copy(s, text)
// make it executable
mprotect(addr, size)
// assign addresses
mod.text = addr
mod.etext = addr + uintptr(size)
mod.minpc = addr
mod.maxpc = addr + uintptr(len(text))
// cache funcdata and findfuncbucket
moduleCache.Lock()
moduleCache.m[mod] = cache
moduleCache.Unlock()
mod.gofunc = uintptr(unsafe.Pointer(&cache[fstart]))
mod.findfunctab = uintptr(unsafe.Pointer(&cache[ffstart]))
// make pc header
mod.pcHeader = &pcHeader {
magic : _Magic,
minLC : _MinLC,
ptrSize : _PtrSize,
nfunc : len(funcs),
nfiles: uint(len(cu)),
textStart: mod.text,
funcnameOffset: getOffsetOf(moduledata{}, "funcnametab"),
cuOffset: getOffsetOf(moduledata{}, "cutab"),
filetabOffset: getOffsetOf(moduledata{}, "filetab"),
pctabOffset: getOffsetOf(moduledata{}, "pctab"),
pclnOffset: getOffsetOf(moduledata{}, "pclntable"),
}
// sepecial case: gcdata and gcbss must by non-empty
mod.gcdata = uintptr(unsafe.Pointer(&emptyByte))
mod.gcbss = uintptr(unsafe.Pointer(&emptyByte))
return
}
// makePctab generates pcdelta->valuedelta tables for functions,
// and returns the table and the entry offset of every kind pcdata in the table.
func makePctab(funcs []Func, cuOffset []uint32, nameOffset []int32) (pctab []byte, pcdataOffs [][]uint32, _funcs []_func) {
_funcs = make([]_func, len(funcs))
// Pctab offsets of 0 are considered invalid in the runtime. We respect
// that by just padding a single byte at the beginning of runtime.pctab,
// that way no real offsets can be zero.
pctab = make([]byte, 1, 12*len(funcs)+1)
pcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
_f := &_funcs[i]
var writer = func(pc *Pcdata) {
var ab []byte
var err error
if pc != nil {
ab, err = pc.MarshalBinary()
if err != nil {
panic(err)
}
pcdataOffs[i] = append(pcdataOffs[i], uint32(len(pctab)))
} else {
ab = []byte{0}
pcdataOffs[i] = append(pcdataOffs[i], _PCDATA_INVALID_OFFSET)
}
pctab = append(pctab, ab...)
}
if f.Pcsp != nil {
_f.pcsp = uint32(len(pctab))
}
writer(f.Pcsp)
if f.Pcfile != nil {
_f.pcfile = uint32(len(pctab))
}
writer(f.Pcfile)
if f.Pcline != nil {
_f.pcln = uint32(len(pctab))
}
writer(f.Pcline)
writer(f.PcUnsafePoint)
writer(f.PcStackMapIndex)
writer(f.PcInlTreeIndex)
writer(f.PcArgLiveIndex)
_f.entryOff = f.EntryOff
_f.nameOff = nameOffset[i]
_f.args = f.ArgsSize
_f.deferreturn = f.DeferReturn
// NOTICE: _func.pcdata is always as [PCDATA_UnsafePoint(0) : PCDATA_ArgLiveIndex(3)]
_f.npcdata = uint32(_N_PCDATA)
_f.cuOffset = cuOffset[i]
_f.funcID = f.ID
_f.flag = f.Flag
_f.nfuncdata = uint8(_N_FUNCDATA)
}
return
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argptrs uintptr, localptrs uintptr) {}

View File

@@ -20,10 +20,6 @@
package loader
import (
`encoding`
`os`
`unsafe`
`github.com/bytedance/sonic/internal/rt`
)
@@ -51,8 +47,6 @@ type moduledata struct {
end, gcdata, gcbss uintptr
types, etypes uintptr
rodata uintptr
// TODO: generate funcinfo object to memory
gofunc uintptr // go.func.* is actual funcinfo object in image
textsectmap []textSection // see runtime/symtab.go: textAddr()
@@ -118,428 +112,3 @@ type _func struct {
//
// funcdata [nfuncdata]uint32
}
type funcTab struct {
entry uint32
funcoff uint32
}
type pcHeader struct {
magic uint32 // 0xFFFFFFF0
pad1, pad2 uint8 // 0,0
minLC uint8 // min instruction size
ptrSize uint8 // size of a ptr in bytes
nfunc int // number of functions in the module
nfiles uint // number of entries in the file tab
textStart uintptr // base for function entry PC offsets in this module, equal to moduledata.text
funcnameOffset uintptr // offset to the funcnametab variable from pcHeader
cuOffset uintptr // offset to the cutab variable from pcHeader
filetabOffset uintptr // offset to the filetab variable from pcHeader
pctabOffset uintptr // offset to the pctab variable from pcHeader
pclnOffset uintptr // offset to the pclntab variable from pcHeader
}
type bitVector struct {
n int32 // # of bits
bytedata *uint8
}
type ptabEntry struct {
name int32
typ int32
}
type textSection struct {
vaddr uintptr // prelinked section vaddr
end uintptr // vaddr + section length
baseaddr uintptr // relocated section address
}
type modulehash struct {
modulename string
linktimehash string
runtimehash *string
}
// findfuncbucket is an array of these structures.
// Each bucket represents 4096 bytes of the text segment.
// Each subbucket represents 256 bytes of the text segment.
// To find a function given a pc, locate the bucket and subbucket for
// that pc. Add together the idx and subbucket value to obtain a
// function index. Then scan the functab array starting at that
// index to find the target function.
// This table uses 20 bytes for every 4096 bytes of code, or ~0.5% overhead.
type findfuncbucket struct {
idx uint32
_SUBBUCKETS [16]byte
}
// func name table format:
// nameOff[0] -> namePartA namePartB namePartC \x00
// nameOff[1] -> namePartA namePartB namePartC \x00
// ...
func makeFuncnameTab(funcs []Func) (tab []byte, offs []int32) {
offs = make([]int32, len(funcs))
offset := 0
for i, f := range funcs {
offs[i] = int32(offset)
a, b, c := funcNameParts(f.Name)
tab = append(tab, a...)
tab = append(tab, b...)
tab = append(tab, c...)
tab = append(tab, 0)
offset += len(a) + len(b) + len(c) + 1
}
return
}
type compilationUnit struct {
fileNames []string
}
// CU table format:
// cuOffsets[0] -> filetabOffset[0] filetabOffset[1] ... filetabOffset[len(CUs[0].fileNames)-1]
// cuOffsets[1] -> filetabOffset[len(CUs[0].fileNames)] ... filetabOffset[len(CUs[0].fileNames) + len(CUs[1].fileNames)-1]
// ...
//
// file name table format:
// filetabOffset[0] -> CUs[0].fileNames[0] \x00
// ...
// filetabOffset[len(CUs[0]-1)] -> CUs[0].fileNames[len(CUs[0].fileNames)-1] \x00
// ...
// filetabOffset[SUM(CUs,fileNames)-1] -> CUs[len(CU)-1].fileNames[len(CUs[len(CU)-1].fileNames)-1] \x00
func makeFilenametab(cus []compilationUnit) (cutab []uint32, filetab []byte, cuOffsets []uint32) {
cuOffsets = make([]uint32, len(cus))
cuOffset := 0
fileOffset := 0
for i, cu := range cus {
cuOffsets[i] = uint32(cuOffset)
for _, name := range cu.fileNames {
cutab = append(cutab, uint32(fileOffset))
fileOffset += len(name) + 1
filetab = append(filetab, name...)
filetab = append(filetab, 0)
}
cuOffset += len(cu.fileNames)
}
return
}
func writeFuncdata(out *[]byte, funcs []Func) (fstart int, funcdataOffs [][]uint32) {
fstart = len(*out)
*out = append(*out, byte(0))
offs := uint32(1)
funcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
var writer = func(fd encoding.BinaryMarshaler) {
var ab []byte
var err error
if fd != nil {
ab, err = fd.MarshalBinary()
if err != nil {
panic(err)
}
funcdataOffs[i] = append(funcdataOffs[i], offs)
} else {
ab = []byte{0}
funcdataOffs[i] = append(funcdataOffs[i], _INVALID_FUNCDATA_OFFSET)
}
*out = append(*out, ab...)
offs += uint32(len(ab))
}
writer(f.ArgsPointerMaps)
writer(f.LocalsPointerMaps)
writer(f.StackObjects)
writer(f.InlTree)
writer(f.OpenCodedDeferInfo)
writer(f.ArgInfo)
writer(f.ArgLiveInfo)
writer(f.WrapInfo)
}
return
}
func makeFtab(funcs []_func, lastFuncSize uint32) (ftab []funcTab) {
// Allocate space for the pc->func table. This structure consists of a pc offset
// and an offset to the func structure. After that, we have a single pc
// value that marks the end of the last function in the binary.
var size int64 = int64(len(funcs)*2*4 + 4)
var startLocations = make([]uint32, len(funcs))
for i, f := range funcs {
size = rnd(size, int64(_PtrSize))
//writePCToFunc
startLocations[i] = uint32(size)
size += int64(uint8(_FUNC_SIZE)+f.nfuncdata*4+uint8(f.npcdata)*4)
}
ftab = make([]funcTab, 0, len(funcs)+1)
// write a map of pc->func info offsets
for i, f := range funcs {
ftab = append(ftab, funcTab{uint32(f.entryOff), uint32(startLocations[i])})
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
ftab = append(ftab, funcTab{uint32(lastFunc.entryOff + lastFuncSize), 0})
return
}
// Pcln table format: [...]funcTab + [...]_Func
func makePclntable(funcs []_func, lastFuncSize uint32, pcdataOffs [][]uint32, funcdataOffs [][]uint32) (pclntab []byte) {
// Allocate space for the pc->func table. This structure consists of a pc offset
// and an offset to the func structure. After that, we have a single pc
// value that marks the end of the last function in the binary.
var size int64 = int64(len(funcs)*2*4 + 4)
var startLocations = make([]uint32, len(funcs))
for i := range funcs {
size = rnd(size, int64(_PtrSize))
//writePCToFunc
startLocations[i] = uint32(size)
size += int64(int(_FUNC_SIZE)+len(funcdataOffs[i])*4+len(pcdataOffs[i])*4)
}
pclntab = make([]byte, size, size)
// write a map of pc->func info offsets
offs := 0
for i, f := range funcs {
byteOrder.PutUint32(pclntab[offs:offs+4], uint32(f.entryOff))
byteOrder.PutUint32(pclntab[offs+4:offs+8], uint32(startLocations[i]))
offs += 8
}
// Final entry of table is just end pc offset.
lastFunc := funcs[len(funcs)-1]
byteOrder.PutUint32(pclntab[offs:offs+4], uint32(lastFunc.entryOff+lastFuncSize))
// write func info table
for i, f := range funcs {
off := startLocations[i]
// write _func structure to pclntab
fb := rt.BytesFrom(unsafe.Pointer(&f), int(_FUNC_SIZE), int(_FUNC_SIZE))
copy(pclntab[off:off+uint32(_FUNC_SIZE)], fb)
off += uint32(_FUNC_SIZE)
// NOTICE: _func.pcdata always starts from PcUnsafePoint, which is index 3
for j := 3; j < len(pcdataOffs[i]); j++ {
byteOrder.PutUint32(pclntab[off:off+4], uint32(pcdataOffs[i][j]))
off += 4
}
// funcdata refs as offsets from gofunc
for _, funcdata := range funcdataOffs[i] {
byteOrder.PutUint32(pclntab[off:off+4], uint32(funcdata))
off += 4
}
}
return
}
// findfunc table used to map pc to belonging func,
// returns the index in the func table.
//
// All text section are divided into buckets sized _BUCKETSIZE(4K):
// every bucket is divided into _SUBBUCKETS sized _SUB_BUCKETSIZE(64),
// and it has a base idx to plus the offset stored in jth subbucket.
// see findfunc() in runtime/symtab.go
func writeFindfunctab(out *[]byte, ftab []funcTab) (start int) {
start = len(*out)
max := ftab[len(ftab)-1].entry
min := ftab[0].entry
nbuckets := (max - min + _BUCKETSIZE - 1) / _BUCKETSIZE
n := (max - min + _SUB_BUCKETSIZE - 1) / _SUB_BUCKETSIZE
tab := make([]findfuncbucket, 0, nbuckets)
var s, e = 0, 0
for i := 0; i<int(nbuckets); i++ {
var pc = min + uint32((i+1)*_BUCKETSIZE)
// find the end func of the bucket
for ; e < len(ftab)-1 && ftab[e+1].entry <= pc; e++ {}
// store the start func of the bucket
var fb = findfuncbucket{idx: uint32(s)}
for j := 0; j<_SUBBUCKETS && (i*_SUBBUCKETS+j)<int(n); j++ {
pc = min + uint32(i*_BUCKETSIZE) + uint32((j+1)*_SUB_BUCKETSIZE)
var ss = s
// find the end func of the subbucket
for ; ss < len(ftab)-1 && ftab[ss+1].entry <= pc; ss++ {}
// store the start func of the subbucket
fb._SUBBUCKETS[j] = byte(uint32(s) - fb.idx)
s = ss
}
s = e
tab = append(tab, fb)
}
// write findfuncbucket
if len(tab) > 0 {
size := int(unsafe.Sizeof(findfuncbucket{}))*len(tab)
*out = append(*out, rt.BytesFrom(unsafe.Pointer(&tab[0]), size, size)...)
}
return
}
func makeModuledata(name string, filenames []string, funcs []Func, text []byte) (mod *moduledata) {
mod = new(moduledata)
mod.modulename = name
// make filename table
cu := make([]string, 0, len(filenames))
for _, f := range filenames {
cu = append(cu, f)
}
cutab, filetab, cuOffs := makeFilenametab([]compilationUnit{{cu}})
mod.cutab = cutab
mod.filetab = filetab
// make funcname table
funcnametab, nameOffs := makeFuncnameTab(funcs)
mod.funcnametab = funcnametab
// make pcdata table
// NOTICE: _func only use offset to index pcdata, thus no need mmap() pcdata
pctab, pcdataOffs, _funcs := makePctab(funcs, cuOffs, nameOffs)
mod.pctab = pctab
// write func data
// NOTICE: _func use mod.gofunc+offset to directly point funcdata, thus need cache funcdata
// TODO: estimate accurate capacity
cache := make([]byte, 0, len(funcs)*int(_PtrSize))
fstart, funcdataOffs := writeFuncdata(&cache, funcs)
// make pc->func (binary search) func table
lastFuncsize := funcs[len(funcs)-1].TextSize
ftab := makeFtab(_funcs, lastFuncsize)
mod.ftab = ftab
// write pc->func (modmap) findfunc table
ffstart := writeFindfunctab(&cache, ftab)
// make pclnt table
pclntab := makePclntable(_funcs, lastFuncsize, pcdataOffs, funcdataOffs)
mod.pclntable = pclntab
// mmap() text and funcdata segements
p := os.Getpagesize()
size := int(rnd(int64(len(text)), int64(p)))
addr := mmap(size)
// copy the machine code
s := rt.BytesFrom(unsafe.Pointer(addr), len(text), size)
copy(s, text)
// make it executable
mprotect(addr, size)
// assign addresses
mod.text = addr
mod.etext = addr + uintptr(size)
mod.minpc = addr
mod.maxpc = addr + uintptr(len(text))
// cache funcdata and findfuncbucket
moduleCache.Lock()
moduleCache.m[mod] = cache
moduleCache.Unlock()
mod.gofunc = uintptr(unsafe.Pointer(&cache[fstart]))
mod.findfunctab = uintptr(unsafe.Pointer(&cache[ffstart]))
// make pc header
mod.pcHeader = &pcHeader {
magic : _Magic,
minLC : _MinLC,
ptrSize : _PtrSize,
nfunc : len(funcs),
nfiles: uint(len(cu)),
textStart: mod.text,
funcnameOffset: getOffsetOf(moduledata{}, "funcnametab"),
cuOffset: getOffsetOf(moduledata{}, "cutab"),
filetabOffset: getOffsetOf(moduledata{}, "filetab"),
pctabOffset: getOffsetOf(moduledata{}, "pctab"),
pclnOffset: getOffsetOf(moduledata{}, "pclntable"),
}
// sepecial case: gcdata and gcbss must by non-empty
mod.gcdata = uintptr(unsafe.Pointer(&emptyByte))
mod.gcbss = uintptr(unsafe.Pointer(&emptyByte))
return
}
// makePctab generates pcdelta->valuedelta tables for functions,
// and returns the table and the entry offset of every kind pcdata in the table.
func makePctab(funcs []Func, cuOffset []uint32, nameOffset []int32) (pctab []byte, pcdataOffs [][]uint32, _funcs []_func) {
_funcs = make([]_func, len(funcs))
// Pctab offsets of 0 are considered invalid in the runtime. We respect
// that by just padding a single byte at the beginning of runtime.pctab,
// that way no real offsets can be zero.
pctab = make([]byte, 1, 12*len(funcs)+1)
pcdataOffs = make([][]uint32, len(funcs))
for i, f := range funcs {
_f := &_funcs[i]
var writer = func(pc *Pcdata) {
var ab []byte
var err error
if pc != nil {
ab, err = pc.MarshalBinary()
if err != nil {
panic(err)
}
pcdataOffs[i] = append(pcdataOffs[i], uint32(len(pctab)))
} else {
ab = []byte{0}
pcdataOffs[i] = append(pcdataOffs[i], _PCDATA_INVALID_OFFSET)
}
pctab = append(pctab, ab...)
}
if f.Pcsp != nil {
_f.pcsp = uint32(len(pctab))
}
writer(f.Pcsp)
if f.Pcfile != nil {
_f.pcfile = uint32(len(pctab))
}
writer(f.Pcfile)
if f.Pcline != nil {
_f.pcln = uint32(len(pctab))
}
writer(f.Pcline)
writer(f.PcUnsafePoint)
writer(f.PcStackMapIndex)
writer(f.PcInlTreeIndex)
writer(f.PcArgLiveIndex)
_f.entryOff = f.EntryOff
_f.nameOff = nameOffset[i]
_f.args = f.ArgsSize
_f.deferreturn = f.DeferReturn
// NOTICE: _func.pcdata is always as [PCDATA_UnsafePoint(0) : PCDATA_ArgLiveIndex(3)]
_f.npcdata = uint32(_N_PCDATA)
_f.cuOffset = cuOffset[i]
_f.funcID = f.ID
_f.flag = f.Flag
_f.nfuncdata = uint8(_N_FUNCDATA)
}
return
}
func registerFunction(name string, pc uintptr, textSize uintptr, fp int, args int, size uintptr, argptrs uintptr, localptrs uintptr) {}

View File

@@ -1,28 +0,0 @@
//go:build go1.15 && !go1.16
// +build go1.15,!go1.16
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`github.com/bytedance/sonic/internal/loader`
)
func (self Loader) LoadOne(text []byte, funcName string, frameSize int, argSize int, argStackmap []bool, localStackmap []bool) Function {
return Function(loader.Loader(text).Load(funcName, frameSize, argSize, argStackmap, localStackmap))
}

View File

@@ -1,104 +0,0 @@
//go:build go1.16 && !go1.21
// +build go1.16,!go1.21
/*
* Copyright 2021 ByteDance Inc.
*
* Licensed under the Apache License, Version 2.0 (the "License");
* you may not use this file except in compliance with the License.
* You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package loader
import (
`github.com/bytedance/sonic/internal/rt`
)
// LoadFuncs loads only one function as module, and returns the function pointer
// - text: machine code
// - funcName: function name
// - frameSize: stack frame size.
// - argSize: argument total size (in bytes)
// - argPtrs: indicates if a slot (8 Bytes) of arguments memory stores pointer, from low to high
// - localPtrs: indicates if a slot (8 Bytes) of local variants memory stores pointer, from low to high
//
// WARN:
// - the function MUST has fixed SP offset equaling to this, otherwise it go.gentraceback will fail
// - the function MUST has only one stack map for all arguments and local variants
func (self Loader) LoadOne(text []byte, funcName string, frameSize int, argSize int, argPtrs []bool, localPtrs []bool) Function {
size := uint32(len(text))
fn := Func{
Name: funcName,
TextSize: size,
ArgsSize: int32(argSize),
}
// NOTICE: suppose the function has fixed SP offset equaling to frameSize, thus make only one pcsp pair
fn.Pcsp = &Pcdata{
{PC: size, Val: int32(frameSize)},
}
if self.NoPreempt {
fn.PcUnsafePoint = &Pcdata{
{PC: size, Val: PCDATA_UnsafePointUnsafe},
}
} else {
fn.PcUnsafePoint = &Pcdata{
{PC: size, Val: PCDATA_UnsafePointSafe},
}
}
// NOTICE: suppose the function has only one stack map at index 0
fn.PcStackMapIndex = &Pcdata{
{PC: size, Val: 0},
}
if argPtrs != nil {
args := rt.StackMapBuilder{}
for _, b := range argPtrs {
args.AddField(b)
}
fn.ArgsPointerMaps = args.Build()
}
if localPtrs != nil {
locals := rt .StackMapBuilder{}
for _, b := range localPtrs {
locals.AddField(b)
}
fn.LocalsPointerMaps = locals.Build()
}
out := Load(text, []Func{fn}, self.Name + funcName, []string{self.File})
return out[0]
}
// Load loads given machine codes and corresponding function information into go moduledata
// and returns runnable function pointer
// WARN: this API is experimental, use it carefully
func Load(text []byte, funcs []Func, modulename string, filenames []string) (out []Function) {
// generate module data and allocate memory address
mod := makeModuledata(modulename, filenames, funcs, text)
// verify and register the new module
moduledataverify1(mod)
registerModule(mod)
// encapsulate function address
out = make([]Function, len(funcs))
for i, f := range funcs {
m := uintptr(mod.text + uintptr(f.EntryOff))
out[i] = Function(&m)
}
return
}

View File

@@ -16,6 +16,10 @@
package loader
import (
`encoding/binary`
)
const (
_N_PCDATA = 4
@@ -49,40 +53,16 @@ const (
var emptyByte byte
func encodeValue(v int) []byte {
return encodeVariant(toZigzag(v))
}
func toZigzag(v int) int {
return (v << 1) ^ (v >> 31)
}
func encodeVariant(v int) []byte {
var u int
var r []byte
/* split every 7 bits */
for v > 127 {
u = v & 0x7f
v = v >> 7
r = append(r, byte(u) | 0x80)
}
/* check for last one */
if v == 0 {
return r
}
/* add the last one */
r = append(r, byte(v))
return r
}
// Pcvalue is the program count corresponding to the value Val
// WARN: we use relative value here (to function entry)
type Pcvalue struct {
PC uint32 // PC offset from func entry
Val int32
PC uint32 // program count relative to function entry
Val int32 // value relative to the value in function entry
}
// Pcdata represents pc->value mapping table.
// WARN: we use ** [Pcdata[i].PC, Pcdata[i+1].PC) **
// as the range where the Pcdata[i].Val is effective.
type Pcdata []Pcvalue
// see https://docs.google.com/document/d/1lyPIbmsYbXnpNj57a261hgOYVpNRcgydurVQIyZOz_o/pub
@@ -90,11 +70,24 @@ func (self Pcdata) MarshalBinary() (data []byte, err error) {
// delta value always starts from -1
sv := int32(_PCDATA_START_VAL)
sp := uint32(0)
buf := make([]byte, binary.MaxVarintLen32)
for _, v := range self {
data = append(data, encodeVariant(toZigzag(int(v.Val - sv)))...)
data = append(data, encodeVariant(int(v.PC - sp))...)
if v.PC < sp {
panic("PC must be in ascending order!")
}
dp := uint64(v.PC - sp)
dv := int64(v.Val - sv)
if dv == 0 || dp == 0 {
continue
}
n := binary.PutVarint(buf, dv)
data = append(data, buf[:n]...)
n2 := binary.PutUvarint(buf, dp)
data = append(data, buf[:n2]...)
sp = v.PC
sv = v.Val
}
// put 0 to indicate ends
data = append(data, 0)
return
}

View File

@@ -1,4 +1,4 @@
// +build amd64,go1.15,!go1.21
// +build amd64,go1.16,!go1.22
/*
* Copyright 2021 ByteDance Inc.

View File

@@ -19,10 +19,11 @@ NATIVE_SRC += $(wildcard native/*.c)
all: native_amd64.s
clean:
rm -vf native_amd64.s output/*.s
rm -vf native_text_amd64.go native_subr_amd64.go output/*.s
native_amd64.s: ${NATIVE_SRC} ${NATIVE_ASM} native_amd64.go
mkdir -p output
clang ${CFLAGS} -S -o output/native.s native/native.c
python3 tools/asm2asm/asm2asm.py native_amd64.s output/native.s ${NATIVE_ASM}
asmfmt -w native_amd64.s
python3 tools/asm2asm/asm2asm.py -r native_amd64.go output/native.s ${NATIVE_ASM}
awk '{gsub(/Text__native_entry__/, "text__native_entry__")}1' native_text_amd64.go > native_text_amd64.go.tmp && mv native_text_amd64.go.tmp native_text_amd64.go
awk '{gsub(/Funcs/, "funcs")}1' native_subr_amd64.go > native_subr_amd64.go.tmp && mv native_subr_amd64.go.tmp native_subr_amd64.go

View File

@@ -71,7 +71,7 @@ func (self Encoding) Encode(out []byte, src []byte) {
//
// It will also update the length of out.
func (self Encoding) EncodeUnsafe(out *[]byte, src []byte) {
__b64encode(out, &src, int(self) | archFlags)
b64encode(out, &src, int(self) | archFlags)
}
// EncodeToString returns the base64 encoding of src.
@@ -120,7 +120,7 @@ func (self Encoding) Decode(out []byte, src []byte) (int, error) {
//
// It will also update the length of out.
func (self Encoding) DecodeUnsafe(out *[]byte, src []byte) (int, error) {
if n := __b64decode(out, mem2addr(src), len(src), int(self) | archFlags); n >= 0 {
if n := b64decode(out, mem2addr(src), len(src), int(self) | archFlags); n >= 0 {
return n, nil
} else {
return 0, base64.CorruptInputError(-n - 1)
@@ -149,9 +149,3 @@ func (self Encoding) DecodedLen(n int) int {
return n * 6 / 8
}
}
func init() {
if hasAVX2() {
archFlags = _MODE_AVX2
}
}

View File

@@ -21,3 +21,15 @@ func str2mem(s string) (v []byte) {
func mem2addr(v []byte) unsafe.Pointer {
return *(*unsafe.Pointer)(unsafe.Pointer(&v))
}
// NoEscape hides a pointer from escape analysis. NoEscape is
// the identity function but escape analysis doesn't think the
// output depends on the input. NoEscape is inlined and currently
// compiles down to zero instructions.
// USE CAREFULLY!
//go:nosplit
//goland:noinspection GoVetUnsafePointer
func noEscape(p unsafe.Pointer) unsafe.Pointer {
x := uintptr(p)
return unsafe.Pointer(x ^ 0)
}

View File

@@ -3,14 +3,40 @@ package base64x
import (
`unsafe`
`github.com/bytedance/sonic/loader`
)
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __b64encode(out *[]byte, src *[]byte, mode int)
func b64encode(out *[]byte, src *[]byte, mode int) {
__b64encode(noEscape(unsafe.Pointer(out)), noEscape(unsafe.Pointer(src)), mode)
}
//go:nosplit
//go:noescape
//goland:noinspection GoUnusedParameter
func __b64decode(out *[]byte, src unsafe.Pointer, len int, mode int) (ret int)
func b64decode(out *[]byte, src unsafe.Pointer, len int, mode int) (ret int) {
return __b64decode(noEscape(unsafe.Pointer(out)), noEscape(unsafe.Pointer(src)), len, mode)
}
// asm2asm templates
var (
__b64encode func(out unsafe.Pointer, src unsafe.Pointer, mod int)
__b64decode func(out unsafe.Pointer, src unsafe.Pointer, len int, mod int) (ret int)
)
// directly jump PCs
var (
_subr__b64encode uintptr
_subr__b64decode uintptr
)
var stubs = []loader.GoC{
{"_b64encode", &_subr__b64encode, &__b64encode},
{"_b64decode", &_subr__b64decode, &__b64decode},
}
func init() {
if hasAVX2() {
archFlags = _MODE_AVX2
}
loader.WrapGoC(text__native_entry__, funcs, stubs, "base64x", "base64x/native.c")
}

File diff suppressed because it is too large Load Diff

View File

@@ -3,27 +3,61 @@
package base64x
//go:nosplit
//go:noescape
//goland:noinspection ALL
func __native_entry__() uintptr
var (
_subr__b64decode = __native_entry__() + 1563
_subr__b64encode = __native_entry__() + 301
import (
`github.com/bytedance/sonic/loader`
)
const (
_stack__b64decode = 128
_entry__b64decode = 1328
_entry__b64encode = 256
)
const (
_stack__b64decode = 152
_stack__b64encode = 40
)
var (
_ = _subr__b64decode
_ = _subr__b64encode
const (
_size__b64decode = 17616
_size__b64encode = 864
)
const (
_ = _stack__b64decode
_ = _stack__b64encode
var (
_pcsp__b64decode = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{12, 40},
{13, 48},
{17560, 152},
{17564, 48},
{17565, 40},
{17567, 32},
{17569, 24},
{17571, 16},
{17573, 8},
{17577, 0},
{17608, 152},
}
_pcsp__b64encode = [][2]uint32{
{1, 0},
{4, 8},
{6, 16},
{8, 24},
{10, 32},
{852, 40},
{853, 32},
{855, 24},
{857, 16},
{859, 8},
{864, 0},
}
)
var funcs = []loader.CFunc{
{"__native_entry__", 0, 67, 0, nil},
{"_b64decode", _entry__b64decode, _size__b64decode, _stack__b64decode, _pcsp__b64decode},
{"_b64encode", _entry__b64encode, _size__b64encode, _stack__b64encode, _pcsp__b64encode},
}

View File

@@ -435,6 +435,7 @@ Exit Code 1
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
| TDX_GUEST | Intel Trust Domain Extensions Guest |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |

View File

@@ -226,6 +226,7 @@ const (
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation
TDX_GUEST // Intel Trust Domain Extensions Guest
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
@@ -1186,13 +1187,8 @@ func support() flagSet {
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx&(1<<14) != 0, PREFETCHI)
// CPUID.(EAX=7, ECX=1).EAX
eax1, _, _, _ := cpuidex(7, 1)
eax1, _, _, edx1 := cpuidex(7, 1)
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
@@ -1202,6 +1198,11 @@ func support() flagSet {
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
fs.setIf(eax1&(1<<26) != 0, LAM)
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
// Check for OS support
@@ -1393,6 +1394,13 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21)
identity := string(valAsString(ebx, edx, ecx))
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
}
return fs
}

View File

@@ -166,59 +166,60 @@ func _() {
_ = x[SYSCALL-156]
_ = x[SYSEE-157]
_ = x[TBM-158]
_ = x[TLB_FLUSH_NESTED-159]
_ = x[TME-160]
_ = x[TOPEXT-161]
_ = x[TSCRATEMSR-162]
_ = x[TSXLDTRK-163]
_ = x[VAES-164]
_ = x[VMCBCLEAN-165]
_ = x[VMPL-166]
_ = x[VMSA_REGPROT-167]
_ = x[VMX-168]
_ = x[VPCLMULQDQ-169]
_ = x[VTE-170]
_ = x[WAITPKG-171]
_ = x[WBNOINVD-172]
_ = x[WRMSRNS-173]
_ = x[X87-174]
_ = x[XGETBV1-175]
_ = x[XOP-176]
_ = x[XSAVE-177]
_ = x[XSAVEC-178]
_ = x[XSAVEOPT-179]
_ = x[XSAVES-180]
_ = x[AESARM-181]
_ = x[ARMCPUID-182]
_ = x[ASIMD-183]
_ = x[ASIMDDP-184]
_ = x[ASIMDHP-185]
_ = x[ASIMDRDM-186]
_ = x[ATOMICS-187]
_ = x[CRC32-188]
_ = x[DCPOP-189]
_ = x[EVTSTRM-190]
_ = x[FCMA-191]
_ = x[FP-192]
_ = x[FPHP-193]
_ = x[GPA-194]
_ = x[JSCVT-195]
_ = x[LRCPC-196]
_ = x[PMULL-197]
_ = x[SHA1-198]
_ = x[SHA2-199]
_ = x[SHA3-200]
_ = x[SHA512-201]
_ = x[SM3-202]
_ = x[SM4-203]
_ = x[SVE-204]
_ = x[lastID-205]
_ = x[TDX_GUEST-159]
_ = x[TLB_FLUSH_NESTED-160]
_ = x[TME-161]
_ = x[TOPEXT-162]
_ = x[TSCRATEMSR-163]
_ = x[TSXLDTRK-164]
_ = x[VAES-165]
_ = x[VMCBCLEAN-166]
_ = x[VMPL-167]
_ = x[VMSA_REGPROT-168]
_ = x[VMX-169]
_ = x[VPCLMULQDQ-170]
_ = x[VTE-171]
_ = x[WAITPKG-172]
_ = x[WBNOINVD-173]
_ = x[WRMSRNS-174]
_ = x[X87-175]
_ = x[XGETBV1-176]
_ = x[XOP-177]
_ = x[XSAVE-178]
_ = x[XSAVEC-179]
_ = x[XSAVEOPT-180]
_ = x[XSAVES-181]
_ = x[AESARM-182]
_ = x[ARMCPUID-183]
_ = x[ASIMD-184]
_ = x[ASIMDDP-185]
_ = x[ASIMDHP-186]
_ = x[ASIMDRDM-187]
_ = x[ATOMICS-188]
_ = x[CRC32-189]
_ = x[DCPOP-190]
_ = x[EVTSTRM-191]
_ = x[FCMA-192]
_ = x[FP-193]
_ = x[FPHP-194]
_ = x[GPA-195]
_ = x[JSCVT-196]
_ = x[LRCPC-197]
_ = x[PMULL-198]
_ = x[SHA1-199]
_ = x[SHA2-200]
_ = x[SHA3-201]
_ = x[SHA512-202]
_ = x[SM3-203]
_ = x[SM4-204]
_ = x[SVE-205]
_ = x[lastID-206]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1198, 1201, 1207, 1217, 1225, 1229, 1238, 1242, 1254, 1257, 1267, 1270, 1277, 1285, 1292, 1295, 1302, 1305, 1310, 1316, 1324, 1330, 1336, 1344, 1349, 1356, 1363, 1371, 1378, 1383, 1388, 1395, 1399, 1401, 1405, 1408, 1413, 1418, 1423, 1427, 1431, 1435, 1441, 1444, 1447, 1450, 1456}
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {

View File

@@ -79,6 +79,7 @@ cover() {
go test -covermode=atomic -coverpkg=./... -coverprofile=coverage.out.tmp ./...
cat coverage.out.tmp | grep -v fuzz | grep -v testsuite | grep -v tomltestgen | grep -v gotoml-test-decoder > coverage.out
go tool cover -func=coverage.out
echo "Coverage profile for ${branch}: ${dir}/coverage.out" >&2
popd
if [ "${branch}" != "HEAD" ]; then

View File

@@ -273,7 +273,7 @@ func (enc *Encoder) encode(b []byte, ctx encoderCtx, v reflect.Value) ([]byte, e
return enc.encodeMap(b, ctx, v)
case reflect.Struct:
return enc.encodeStruct(b, ctx, v)
case reflect.Slice:
case reflect.Slice, reflect.Array:
return enc.encodeSlice(b, ctx, v)
case reflect.Interface:
if v.IsNil() {
@@ -930,7 +930,7 @@ func willConvertToTableOrArrayTable(ctx encoderCtx, v reflect.Value) bool {
return willConvertToTableOrArrayTable(ctx, v.Elem())
}
if t.Kind() == reflect.Slice {
if t.Kind() == reflect.Slice || t.Kind() == reflect.Array {
if v.Len() == 0 {
// An empty slice should be a kv = [].
return false

View File

@@ -1170,10 +1170,10 @@ func initAndDereferencePointer(v reflect.Value) reflect.Value {
// Same as reflect.Value.FieldByIndex, but creates pointers if needed.
func fieldByIndex(v reflect.Value, path []int) reflect.Value {
for i, x := range path {
for _, x := range path {
v = v.Field(x)
if i < len(path)-1 && v.Kind() == reflect.Ptr {
if v.Kind() == reflect.Ptr {
if v.IsNil() {
v.Set(reflect.New(v.Type().Elem()))
}

Some files were not shown because too many files have changed in this diff Show More